n?Xٟ_5 *FHrt?Ubkv<f*MYgzJV_ %1?DIKUY[ahk %*,,48EJNPS`ks!+=V`grw(/;BKU`js~    / 6 < B H P \ e p } 3 > A P Y ] ` e i w   + 8 A P Z ] g x    ) . 3 ; H S X ] o    ! ' 0 ; G M T c m w {  %)08?GKPZ`cipu~(c(>Rkw -=FQ]lx  9o$DTX=r 8l IsxN'>KP3jPr ?r})_&8gq'bt - S U W Y u !!@!D!]!o!!!!!""9"f"h"j"l"n"p"r"t"v"""# #3#e###############$*$U$u$$%%(%R%{%%&&0&Q&S&X&]&b&g&n&u&|&&&&&&&&&&&&&&&' '<'B'L'P'_'r''''''''''((C(K(W(\(d((())D)r))**7*j***+++.+a+++++++,,-,N,z,,,,,,--->-T-W-Y-s---..?.G.f.{..../!/D/W/i/n/v/y/{////////0 00%0:0?0O0_0j000000000000000111111&1:1C1T1f1112+2_2e2k2q2222313k3o3q3u33334*4Y4v44455A5s555556#6Y66666666666677 77#7(7-7:7?7J7Z77778*8>8P8o8}888888889969j99999::N:V:_:j:x:::::::::::;;;;!;-;S;{;;;<<8<;<>>?>h>>>???K?{???@@J@M@Q@V@Z@_@b@i@n@r@w@z@@@AA<AtAzAAABB'B=BwBBC'COCWC`CeCjCnCuCyC}CCCCCCD DBDtDDEE%E:EjEEEFFQFWF_FyFFFGG<G[GGGGGGGGGGH7H_HkHxHHHIIDI|IIJJJAJmJJJK K?KsKKLLGLxLLMMMMM!M/M>MBMHMrMtMyM{MMMMMMMMMMMMMN NN'N4N@NJNWNdNnNxNNNNNNNNNNNNOOO OO@OyOOPP;PoPPPQQ:QuQQQQQQQR RR%RHRRRRRRSSSS SQSSSTTHTzTTTU UEUvUUUUUUUUUUUUVVV!VRVsVVWWSW}WWWWWWWWWWWXX(X1X9XGXkXXXXXYY;YrYYYZZ<ZcZmZuZyZZZZZZZZ[[5[m[y[[[[[[[\ \V\\\\\\\\]]>]t]]]]]]]]^^^+^C^\^^^^^^^^^___ __"_2_L_b_d_q_____````$`+`4`?`T`f`m`t`z````````````````aa a!a\a`apaxa|aaaaaaaabb0b9bCbSbdbob{bbbbbbbbbccBcjccccccccccd dd%d5dJdTdnddddddde6e?eHeMezeeeeeeeeeeeeeeefff fff!f&f+f3f9fAfHfQfWf^feflftfzffffffffffffffffggg$g'g>gVgaghgmgrgugggggggggggggggggggghhhh hhhhh h%h'h*h/h1h4h;h=h@hBhDhGhIhKhNhPhRhUhXhZh]h`hbhehkhmhph}hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhiii i iiii i"i%i+i-i0i1i3i6i7i9i<i=i?iBiCiEiHiIiKiNiSiUiXiYi[i^i_iaidieigijikimipiqisiviwiyi|i}iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiijjjjjj j jjjjjjjjjj j"j%j&j(j+j,j.j1j2j4j7j8j:j=j>j@jCjDjFjIjJjLjOjPjRjUjVjXj[j\j^jajbjdjgjhjjjmjnjpjsjtjvjyjzj|jjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjkkkkkk k kkkkkkkkkk k"k%k&k(k+k,k.k1k2k4k7k8k:k=k>k@kCkDkFkIkJkLkOkPkRkUkVkXk[k\k^kakbkdkgknkpkskzk|kkkkkkkkkkkkkkkkkkkkkkkkklll%l'l+l2l4l8l?lAlElMlOlSlWlYl]lalclglnlpltl}llllllllllllllllllllllllllllllllmmm mmmmm!m%m-m/m3m7m9m=mAmCmGmKmMmQmUmWm[m`mbmfmmmomsmxmzm~mmmmmmmmmmmmmmmmmmmmmmmmmmmnnnnnnn%n'n+n<n>nBnRnTnXnjnlnpnwnyn}nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnooooo o ooooooo"o(o*o.o7o9o=o>o@oDoEoGoKoLoNoRoSoUoYoZo\o`oaocogohojonoooqouovoxo|o}ooooooooooooooooooooooooooooooooooooooooooooooooooooopp ppppp"p$p(p/p1p5p:p<p@pApCpGpHpJpNpOpQpUpVpXp\p]p_pcpdpfpjpkpmpqprptpxpyp{ppppppppppppppppppppppppppppppppppppppppppppppppppppppqq q qqqqq(q*q.q<q>qCqGqLqPqVq[q_qdqhqmqrqvq{qqqqqqqqqqqqqqqqqqqqrrrr rrrrrr!r%r-r/r3r;r=rArIrKrOrUrWr[rdrfrjrprrrvr~rrrrrrrrrrrrrrrrrrrrrrrrrrrrrsss sssss!s%s)s+s/s3s5s9s?sAsEsKsMsQs\s^sbsnspsts}sssssssssssssssssssssssttt tttt+t-t1t:t<t@tItKtOtWtYt]tdtftjtqtstwt{t}tttttttttttttttttttttttttuuuu uuuuuu!u#u'u,u.u2u9u;u?uEuGuKuQuSuWu]u_ucuiukuouuuwu{uuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuvvv vvvvvv#v)v+v/v5v7v;vAvCvGvMvOvSvYv[v_vevgvkvqvsvwv|v~vvvvvvvvvvvvvvvvvvvvvvvvvvvvvvwwww w w wwwww&w(w,w2w4w8w>w@wDwQwSwWwdwfwjwtwvwzw~wwwwwwwwwwwwwwwwwwwwwwwwwwwwwxx x xxxx"x$x(x2x4x8xExGxKxVxXx\xgxixnxrxwx{xxxxxxxxxxxxxxxxxxxxxyyyyyyyyy y$y+y-y1y8y:y>y?yAyEyFyHyLyTyVyZybydyhyqywy{yyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyzzzzzzzzzzzz"z*z,z0z8z:z>zGzMzQzZz`zdzezgzkzlznzrzszuzyzzz|zzzzzzzzzzzzzzzzzzzzzzzzzzzzz{{{{{{"{({,{5{;{?{H{N{R{[{a{e{n{t{x{{{{{{{{{{{{{{{{{{{{{|| ||||#|,|2|6|?|E|I|R|X|\|e|k|o|x|~|||||||||||||||||||||||||||}}} }}}}}"}$}(}0}2}6}>}@}D}I}K}O}U}W}[}`}b}f}k}m}q}v}x}|}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}~~~ ~~~~~!~%~*~,~0~5~7~;~B~D~H~O~Q~U~\~^~b~c~e~i~j~l~p~x~z~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ %)28<EKOX^bkqu~04;=GKOVXbfjqs} "')37;BDNRV^`jnrz| #%/37=?IMQWYcgkqs}  $,.8<@GISW[bdnrv~  ",04;=GKOPR\`degquyz| !"$.2679CGKLNX\`acmquvx #+-7;?@BLPTUWaeijlvz~ "&')37;<>HLPQS]aefhrvz{} "#%/378:DHLMOY]abdnrvwy  ",0457AEIJLVZ^_akostv (,013=AEFHRVZ[]gkopr|$(,-/9=AHJTX\ceosw} @DKMQXZ^egksuy} !%+-179=CEIOQU[]agimsuy !%&(,-/346:;=ABDHIKOPRVWY]^`degklnrsuyz|  !#'(*./1568<=?CDFJKMQRTXY[_`bfgimnptuw{|~  !#'(*./1568<=?CDFJKMQRTXY[_`bfgimnptuw{|~  ')-57;?AEIKOVX\egkprv{} #)+/57;ACGNPT[]ahjnvx| "#%)*,01378:>?AEFHLMOSTVZ[]abdhikoprvwy}  $%'+,.2359:<@ACGHJNOQUVX\]_cdfjqswxz~ !"$()+/02679=>@DEGKLNRSUY`bfmosy{#')-137>@DMOSXZ^ceiprv~ #)+/68<CEIPRV^`dkmqxz~ !%&(,-/346:;=ABDHIKOPRVWY]^`degkrtxy{  !#'(*./1568<=?CDFJKMQRTX_aefhlrtx~  $%'+,.2359:<@ACGNPT[]agimsuy$+-7;@HJTX]acmqvz| ",05;=GKPWYcglsu %).68BFKOQ[_dhjtx} "$.27<>HLQVXbfkrt~ ')37<KMW[`qs}&(26;IKUY^_akotuw $%'15:;=GKPQS]afjlvz  $)*,6:?@BLPUVXbfklnx|(,124>BGHJTX]^`jnstv #)+59>GISW\ceosx "#%/389;EINOQ[_degquz{} !%*+-7;@ACMQVWYcglmoy} ")+59>BDNRWegquz $(-24>BGLNX\ajlvz$*,6:?HJTX]ceosx  %*,6:?GISW\dfpty~ "$.27=?IMR]_imr~ )-2<>HLQ\^hlq} (,19;EINUWaejqs}%'15:BDNRW_akoty{ &*/57AEJPR\`ekmw{ "(*48=CEOSX^`jnsy{ '+068BFKQS]aflnx| !(*48=DFPTY^`jnsz|  *.346@DIQS]afnpz~  ",05;=GKPWYcglsu "$.27?AKOT]_imrxz LQXZ_fhmtv{ #)+0=?DJLQWY^dfkqsx~ !&')./1679>CEJQSXY[`achikpqsxy{ !&')./1679>?AFGINOQVWY^_afginoqvwy~ !').57<=?DEGLMOTUW\]_deglmotuw|} !#(.05;=BHJRX`fimsy !+/59@DMY`fjox#+/7@JNRV^fktz)-5=IQ\ikmoqsuw  -8;=?EJPV\_dhmry}  %*-/13:?GLPSV[ciorvz  -:INRUX[^ekpuz ,5?BDGILNRV\bhnt|„†ˆŒŽž¢¤®´·¼!&49FLR`n{ÈÒäöùþ +4>BLV\bkt}āąČĕĠħİĻ #(,16=CHMQ\cgimqw~łňŏŗŜŤūŴŽ"$&)/58>BEKORX\_cfilorux{~ƁƄƇƉƌƏƓƗƜƢƩưƼ',:J[gsǀǍǔǜǟǨDZǵǹǼ )5=IUamsȤ !*2;GT`lrɂɌɗɞɨpool sizenumber of strings???m2d5c2l5x2v5iEnd of file on the terminal!! (That makes 100 errors; please try again.)? Type <return> to proceed, S to scroll future error messages,R to run without stopping, Q to run quietly,I to insert something, E to edit your file,1 or ... or 9 to ignore the next 1 to 9 tokens of input,H for help, X to quit.OK, entering batchmodenonstopmodescrollmode...insert>I have just deleted some text, as you asked.You can now delete more, or insert, or whatever.Sorry, I don't know how to help in this situation.Maybe you should try asking a human?Sorry, I already gave what help I could...An error might have occurred before I noticed any problems.``If all else fails, read the instructions.'' (Emergency stopOmega capacity exceeded, sorry [If you really absolutely need more capacity,you can ask a wizard to enlarge me.ocp_buf_sizeocp_stack_sizeThis can't happen (I'm broken. Please show this to someone who can fix can fixI can't go on meeting you like thisOne of your faux pas seems to have wounded me deeply...in fact, I'm barely conscious. Please fix it and try again.InterruptionYou rang?Try to insert some instructions for me (e.g.,`I\showlists'),unless you just want to quit by typing `X'.main memory sizeAVAIL list clobbered at Double-AVAIL list clobbered at Doubly free location at Bad flag at New busy locs:LINK(INFO([]CLOBBERED.foulfi plus minus []Bad link, display aborted.etc.Unknown node type!unsetbox()x, shifted , direction columns), stretch , shrink , glue set - < -rule(insert, natural size ; split(); float cost gluenonscriptmskipmuleaders kern (for accent)mkernmathonoff, surrounded (ligature penalty discretionary replacing markvadjustflushingcopyingverticalhorizontaldisplay mathnointernal verticalrestricted horizontal modesemantic nest size### entered at line (language:hyphenmin (\output routine)### recent contributions:prevdepth ignored, prevgraf linespacefactor , current language this will be denominator of:lineskipbaselineskipparskipabovedisplayskipbelowdisplayskipabovedisplayshortskipbelowdisplayshortskipleftskiprightskiptopskipsplittopskiptabskipspaceskipxspaceskipparfillskipthinmuskipmedmuskipthickmuskip[unknown glue parameter!]skipmuskipptoutputeverypareverymatheverydisplayeveryhboxeveryvboxeveryjobeverycrerrhelptoksparshapeboxvoidcurrent fonttextfontscriptfontscriptscriptfontcatcodelccodeuccodesfcodemathcodepretolerancetolerancelinepenaltyhyphenpenaltyexhyphenpenaltyclubpenaltywidowpenaltydisplaywidowpenaltybrokenpenaltybinoppenaltyrelpenaltypredisplaypenaltypostdisplaypenaltyinterlinepenaltydoublehyphendemeritsfinalhyphendemeritsadjdemeritsmagdelimiterfactorloosenesstimedaymonthyearshowboxbreadthshowboxdepthhbadnessvbadnesspausingtracingonlinetracingmacrostracingstatstracingparagraphstracingpagestracingoutputtracinglostcharstracingcommandstracingrestoresuchyphoutputpenaltymaxdeadcycleshangafterfloatingpenaltyglobaldefsfamescapechardefaulthyphenchardefaultskewcharendlinecharnewlinecharlanguagelefthyphenminrighthyphenminholdinginsertserrorcontextlines[unknown integer parameter!]countdelcodeparindentmathsurroundlineskiplimithsizevsizemaxdepthsplitmaxdepthboxmaxdepthhfuzzvfuzzdelimitershortfallnulldelimiterspacescriptspacepredisplaysizedisplaywidthdisplayindentoverfullrulehangindenthoffsetvoffsetemergencystretch[unknown dimen parameter!]dimenEQUIV(notexpanded:hash sizecsnameendcsnameIMPOSSIBLE.NONEXISTENT.accentadvanceafterassignmentaftergroupbegingroupchardelimiterodelimiterdivideendgroupexpandafterfontfontdimenhalignhruleignorespacesleftghostmathaccentmathcharomathaccentomathcharmathchoicemultiplynoalignnoboundarynoexpandomitpenaltyprevgrafradicaloradicalreadrelaxrightghostsetboxthevalignvcentervrulesave sizegrouping levelscurlevelretainingrestoringSAVE(Incompatible magnification (); the previous value will be retainedI can handle only one magnification ratio per job. So I'vereverted to the magnification you used earlier on this run.Illegal magnification has been changed to 1000The magnification ratio must be between 1 and 32768.ETC.BAD.->begin-group character end-group character math shift character macro parameter character superscript character subscript character end of alignment templateblank space the letter the character [unknown command code!]: Runaway definitionargumentpreambletextOCP stack entry <*><insert> <read l.<argument> <template> <recently read> <to be read again> <inserted text> <output> <everypar> <everymath> <everydisplay> <everyhbox> <everyvbox> <everyjob> <everycr> <mark> <write> input stack sizewrite(interwoven alignment preambles are not allowed)text input levelsbuffer sizeparIncomplete ; all text was ignored after line A forbidden control sequence occurred in skipped text.This kind of error happens when you say `\if...' and forgetthe matching `\fi'. I've inserted a `\fi'; this might work.The file ended while I was skipping conditional text.File endedForbidden control sequence found while scanning of I suspect you have forgotten a `}', causing meto read past where you wanted me to stop.I'll try to recover; but if the error is serious,you'd better type `E' or `X' now and fix your file.useText line contains an invalid characterA funny symbol that I can't read has just been input.Continue, and I'll forget that it ever happened.(Please type a command or say `\end')*** (job aborted, no legal \end found)=>Undefined control sequenceThe control sequence at the end of the top lineof your error message was never \def'ed. If you havemisspelled it (e.g., `\hobx'), type `I' and the correctspelling (e.g., `I\hbox'). Otherwise just continue,and I'll forget about whatever was undefined.Missing insertedThe control sequence marked <to be read again> shouldnot appear between \csname and \endcsname.inputendinputtopmarkfirstmarkbotmarksplitfirstmarksplitbotmarkparameter stack sizeArgument of has an extra }I've run across a `}' that doesn't seem to match anything.For example, `\def\a#1{...}' and `\a}' would producethis error. If you simply proceed now, the `\par' thatI've just inserted will cause me to report a runawayargument that might be the root of the problem. But ifyour `}' was spurious, just type `2' and it will go away.Paragraph ended before was completeI suspect you've forgotten a `}', causing me to apply thiscontrol sequence to too much text. How can we recover?My plan is to forget the whole thing and hope for the best.Use of doesn't match its definitionIf you say, e.g., `\def\a1{...}', then you must alwaysput `1' after `\a', since control sequence names aremade up of letters only. The macro here has not beenfollowed by the required stuff, so I'm ignoring it.<-Missing { insertedA left brace was mandatory here, so I've put one in.You might want to delete and/or insert some correctionsso that I will find a matching right brace soon.(If you're confused by all this, try typing `I}' now.)A right brace was mandatory here, so I've put one in.Incompatible glue unitsI'm going to assume that 1mu=1pt when they're mixed.Extended mathchar used as mathcharA mathchar number must be between 0 and "7FFF.I changed this one to zero.Missing number, treated as zeroA number should have been here; I inserted `0'.(If you can't figure out why I needed to see a number,look up `weird error' in the index to The TeXbook.)spacefactorprevdepthdeadcyclesinsertpenaltieswdhtdpcharwdcharhtchardpcharitlastpenaltylastkernlastskipinputlinenobadnessImproper You can refer to \spacefactor only in horizontal mode;you can refer to \prevdepth only in vertical mode; andneither of these is meaningful inside \write. SoI'm forgetting what you said and using zero instead.You can't use `' after Bad directionBad register codeA register number must be between 0 and 65535.Bad character codeA character number must be between 0 and 65535.Bad numberSince I expected to read a number between 0 and 15,Since I expected to read a number between 0 and 255,Bad mathcharA mathchar number must be between 0 and 32767.Bad extended mathcharAn extended mathchar number must be between 0 and "7FFFFFF.Bad delimiter codeA numeric delimiter code must be between 0 and 2^{27}-1.A numeric delimiter (first part) must be between 0 and 2^{27}-1.A numeric delimiter (second part) must be between 0 and 2^{24}-1.Bad token appearing in string argumentmimomnImproper alphabetic constantA one-character control sequence belongs after a ` mark.So I'm essentially inserting \0 here.Number too bigI can only go up to 2147483647='17777777777="7FFFFFFF,so I'm using that number instead of yours.trueIllegal unit of measure (replaced by filll)I dddon't go any higher than filll.emexmu inserted)The unit of measurement in math glue must be mu.To recover gracefully from this error, it's best todelete the erroneous units; e.g., type `2' to deletetwo letters. (See Chapter 27 of The TeXbook.)inpccmmmbpddccsppt inserted)Dimensions can be in units of em, ex, in, pt, pc,cm, mm, dd, cc, bp, or sp; but yours is a new one!I'll assume that you meant to say pt, for printer's points.Dimension too largeI can't work with sizes bigger than about 19 feet.Continue and I'll use the largest value I can.plusminuswidthheightdepthnumberromannumeralstringmeaningfontnameOmegaVersionjobname at 1.15Where was the left brace? You said something like `\def\a}',which I'm going to interpret as `\def\a{}'.You already have nine parametersI'm going to ignore the # sign you just used.Parameters must be numbered consecutivelyI've inserted the digit you should have used after the #.Type `1' to delete what you did use.Illegal parameter number in definition of You meant to type ## instead of #, right?Or maybe a } was forgotten somewhere earlier, and thingsare all screwed up? I'm going to assume that you meant ##.*** (cannot \read from terminal in nonstop modes)File ended within This \read has unbalanced braces.ififcatifnumifdimifoddifvmodeifhmodeifmmodeifinnerifvoidifhboxifvboxifxifeofiftrueiffalseifcaseorelseExtra I'm ignoring this; it doesn't match any \if.{true}{false}Missing = inserted for I was expecting to see `<', `=', or `>'. Didn't.{case OmegaOCPs:.fmtinput file nameI can't find file `I can't write on file `'..texPlease type another *** (job aborted, file error in nonstop mode)file name for output.dvitexput.log**transcript file nameCopyright (c) 1994--2000 John Plaice and Yannis HaralambousnullfontnullfontsortFont scaled not loadable: Bad metric (TFM/OFM) file not loadable: Metric (TFM/OFM) file not foundI wasn't able to read the size data for this font,so I will ignore the font specification.[Wizards can fix TFM files using TFtoPL/PLtoTF.]You might try inserting a different font spec;e.g., type `I\font<same font id>=<substitute font name>'. not loaded: Not enough room leftI'm afraid I won't be able to make use of this font,because my memory for character-size data is too small.If you're really stuck, ask a wizard to enlarge me.Or maybe try `I\font<same font id>=<name of loaded font>'.Missing font identifierI was looking for a control sequence whosecurrent meaning has been defined by \font. has only fontdimen parametersTo increase the number of font parameters, you mustuse \fontdimen immediately after the \font is loaded.Out of font parameter spaceMissing character: There is no in font Active ocps: [nullocpOCP file error (Translation process not loadable: Bad ocp file not loadable: ocp file not foundI wasn't able to read the data for this ocp,so I will ignore the ocp specification.opening file.ocpchecking first octetchecking sizeMissing ocp identifiercurrent meaning has been defined by \ocp.nullocplistwarning: stack entry already emptyStack number too large : , Bad ocp list specificationI was looking for a ocp list specification.Stack numbers must be between 0 and 4096 (exclusive)Missing ocp list identifiercurrent meaning has been defined by \ocplist.Omega output, Version 3.14159--1.15, vlistoutCompleted box being shipped outMemory usage before: after: ; still untouched: Huge page cannot be shipped outThe page just created is more than 18 feet tall ormore than 18 feet wide, so I suspect something went wrong.The following box has been deleted:No pages of output.Output written on page bytes).dirtospreadUnderfullLoose \hbox (badness ) has occurred while \output is active) in paragraph at lines ) in alignment at lines --) detected at line Overfull \hbox (pt too wideTight \hbox (badness vpack \vbox (badness Overfull \vbox (pt too highTight \vbox (badness {}displaystyletextstylescriptstylescriptscriptstyleUnknown style!mathordmathopmathbinmathrelmathopenmathclosemathpunctmathinneroverlineunderlineleftrightlimitsnolimitsfraction, thickness = default, left-delimiter , right-delimiter is undefined (character Somewhere in the math formula just ended, you used thestated character from an undefined font family. For example,plain TeX doesn't allow \it or \sl in subscripts. Proceed,and I'll try to forget that I needed that character.mlist1mlist2mlist30234000122*4000133**3**344*0400400*000000234000111*1111112341011mlist4 inside $$'sDisplays can use special alignments (like \eqalignno)only if nothing but the alignment itself is between $$'s.So I've deleted the formulas that preceded this alignment.spancrcrcrendtemplatealignment tab character Missing # inserted in alignment preambleThere should be exactly one # between &'s, when an\halign or \valign is being set up. In this case you hadnone, so I've put one in; maybe that will work.Only one # is allowed per tabmore than one, so I'm ignoring all but the first.endvExtra alignment tab has been changed to You have given more \span or & marks than there werein the preamble to the \halign or \valign now in progress.So I'll assume that you meant to type \cr instead.too many spansalign1align0Infinite glue shrinkage found in a paragraphThe paragraph just ended includes some glue that hasinfinite shrinkability, e.g., `\hskip 0pt minus 1fil'.Such glue doesn't belong there---it allows a paragraphof any length to fit on one line. But it's safe to proceed,since the offensive shrinkability has been made finite.disc1disc2@@: line t= -> @@ via @@ b= p= d=@firstpass@secondpass@emergencypassparagraphdisc3disc4line breakingHYPH(hyphenation will be flushedHyphenation exceptions must contain only lettersand hyphens. But continue; I'll forgive and forget.Not a letterLetters in \hyphenation words must have \lccode>0.Proceed; I'll ignore the character I just read.exception dictionarypattern memory opspattern memory ops per languagepattern memoryToo late for patternsAll patterns must be given before typesetting begins.Bad (See Appendix H.)NonletterDuplicate patternpruningvertbreakInfinite glue shrinkage found in box being splitThe box you are \vsplitting contains some infinitelyshrinkable glue, e.g., `\vss' or `\vskip 0pt minus 1fil'.Such glue doesn't belong there; but you can safely proceed,vsplit needs a vboxThe box you are trying to split is an \hbox.I can't split such a box, so I'll leave it alone.pagegoalpagetotalpagestretchpagefilstretchpagefillstretchpagefilllstretchpageshrinkpagedepthfilfillfilll### current page: (held over for next output)total height goal height adds , # might split%% goal height=, max depth=Insertions can only be added to a vboxTut tut: You're trying to \insert into a\box register that now contains an \hbox.Proceed, and I'll discard its present contents.pageInfinite glue shrinkage found on current pageThe page about to be output contains some infinitely g= c=Infinite glue shrinkage inserted from The correction glue for page breaking with insertionsmust have finite shrinkability. But you may proceed,% split to 255 is not voidYou shouldn't use \box255 except in \output routines.Output loop--- consecutive dead cyclesI've concluded that your \output is awry; it never does a\shipout, so I'm shipping \box255 out myself. Next timeincrease \maxdeadcycles if you want me to be more patient!Unbalanced output routineYour sneaky output routine has problematic {'s and/or }'s.I can't handle that very well; good luck.Output routine didn't use all of Your \output commands should empty \box255,e.g., by saying `\shipout\box255'.Proceed; I'll discard its present contents.Missing $ insertedI've inserted a begin-math/end-math symbol since I thinkyou left one out. Proceed, with fingers crossed.' in Sorry, but I'm not programmed to handle this case;I'll just pretend that you didn't ask for it.If you're in the wrong mode, you might be able toreturn to the right one by typing `I}' or `I$' or `I\par'.enddumphskiphfilhfillhsshfilnegvskipvfilvfillvssvfilnegI've inserted something that you may have forgotten.(See the <inserted text> above.)With luck, this will get me unwedged. But if youreally didn't forget anything, try typing `2' now; thenmy insertion and my current dilemma will both disappear.right.Things are pretty mixed up, but I think the worst is over.Too many }'sYou've closed more groups than you opened.Such booboos are generally harmless, so keep going.rightbraceExtra }, or forgotten I've deleted a group-closing symbol because it seems to bespurious, as in `$x}$'. But perhaps the } is legitimate andyou forgot something else, as in `\hbox{$x}'. In such casesthe way to recover is to insert both the forgotten and thedeleted material, e.g., by typing `I$}'.moveleftmoverightraiselowercopylastboxvtophboxshipoutleaderscleadersxleadersUnauthorized entry in math expression: The MathML translator cannot continueLeaders not followed by proper glueYou should say `\leaders <box or rule><hskip or vskip>'.I found the <box or rule>, but there's no suitable<hskip or vskip>, so I'm ignoring these leaders.Sorry; this \lastbox will be void.Sorry...I usually can't take things from the current page.This \lastbox will therefore be void.Missing `to' insertedI'm working on `\vsplit<box number> to <dimen>';will look for the <dimen> next.A <box> was supposed to be hereI was expecting to see \hbox or \vbox or \copy or \box orsomething like that. So you might find something missing inyour output. But keep trying; you can fix this later.indentnoindent' here except with leadersTo put a horizontal rule in an hbox or an alignment,you should use \leaders or \hrulefill (see The TeXbook).You can't I'm changing to \insert0; box 255 is special.Try `I\vskip-\lastskip' instead.Try `I\kern-\lastkern' instead.Perhaps you can make the output routine do it.unpenaltyunkernunskipunhboxunhcopyunvboxunvcopyIncompatible list can't be unboxedSorry, Pandora. (You sneaky devil.)I refuse to unbox an \hbox in vertical mode or vice versa.And I can't open any boxes in math mode.localleftboxlocalrightboxIllegal math Sorry: The third part of a discretionary break must beempty, in math formulas. I had to delete your third part.Discretionary list is too longWow---I never thought anybody would tweak me here.You can't seriously need such a huge discretionary list?Improper discretionary listDiscretionary lists must contain only boxes and kerns.The following discretionary sublist has been deleted:Missing } insertedI've put in what seems to be necessary to fixthe current column of the current alignment.Try to go on, since this might almost work.Misplaced I can't figure out why you would want to use a tab markhere. If you just want an ampersand, the remedy issimple: Just type `I\&' now. But if some right braceup above has ended a previous alignment prematurely,you're probably due for more error messages, and youmight try typing `S' now just to see what is salvageable.or \cr or \span just now. If something like a right braceI expect to see \noalign only after the \cr ofan alignment. Proceed, and I'll ignore this case.I expect to see \omit only after tab marks or the \cr ofI'm guessing that you meant to end an alignment here.I'm ignoring this, since I wasn't doing a \csname. > </<mo limits="true" limits="false"mrow </mo><merror> Unrecognized math stuff </merror>="mtext</<mfrac> Arguments </mfrac><msubsup</mTags do not match: mtrmtdshowSGMLentitiesnoshowSGMLentitiesMMLmodenoMMLmodeSGMLstartmathtagSGMLendmathtagSGMLstarttexttagSGMLendtexttagSGMLattributeMMLstarttextMMLendtextSGMLampersandSGMLbackslashSGMLcarretSGMLdollarSGMLhashSGMLleftbraceSGMLpercentSGMLrightbraceSGMLunderscoreSGMLentitySGMLemptytagSGMLlonetagSGMLFontEntitySGMLwriteSGMLwriteln.mmlfalseeqnoleqnodisplaylimitsLimit controls must follow a math operatorI'm ignoring this misplaced \limits or \nolimits command.Missing delimiter (. inserted)I was expecting to see something like `(' or `\{' or`\}' here. If you typed, e.g., `{' instead of `\{', youshould probably delete the `{' by typing `1' now, so thatbraces don't get unbalanced. Otherwise just proceed.Acceptable delimiters are characters whose \delcode isnonnegative, or you can use `\delimiter <delimiter code>'.Please use for accents in math modeI'm changing \accent to \mathaccent here; wish me luck.(Accents are not the same in formulas as they are in text.)Double superscriptI treat `x^1^2' essentially like `x^1{}^2'.Double subscriptI treat `x_1_2' essentially like `x_1{}_2'.aboveoveratopabovewithdelimsoverwithdelimsatopwithdelimsAmbiguous; you need another { and }I'm ignoring this fraction specification, since I don'tknow whether a construction like `x \over y \over z'means `{x \over y} \over z' or `x \over {y \over z}'.mfraclinethickness0exthinthickExpecting closing tag </>.I'm ignoring a \right that had no matching \left.Math formula deleted: Insufficient symbol fontsSorry, but I can't typeset math unless \textfont 2and \scriptfont 2 and \scriptscriptfont 2 have allthe \fontdimen values needed in math symbol fonts.Math formula deleted: Insufficient extension fontsSorry, but I can't typeset math unless \textfont 3and \scriptfont 3 and \scriptscriptfont 3 have allthe \fontdimen values needed in math extension fonts.inlinemathDisplay math should end with $$The `$' that I just saw supposedly matches a previous `$$'.So I shall assume that you typed `$$' both times.displaymathdisplayMissing $$ insertedlongouterglobaldefgdefedefxdefprefixYou can't use a prefix with `I'll pretend you didn't say \long or \outer or \global.' or `' with `I'll pretend you didn't say \long or \outer here.Missing control sequence insertedPlease don't say `\def cs{...}', say `\def\cs{...}'.I've inserted an inaccessible control sequence so that yourdefinition will be completed without mixing me up too badly.You can recover graciously from this error, if you'recareful; see exercise 27.2 in The TeXbook.inaccessibleletfutureletchardefmathchardefomathchardefcountdefdimendefskipdefmuskipdeftoksdefYou should have said `\read<number> to \cs'.I'm going to look for the \cs now.omathcodeodelcodeInvalid code (), should be at most "FFFFFF "FFFFFFI'm going to use 0 instead of that illegal code value.), should be in the range 0..), should be at most byArithmetic overflowI can't carry out that multiplication or division,since the result is out of range.I'm forgetting what you said and not changing anything.Sorry, \setbox is not allowed after \halign in a display,or between \accent and an accented character.Bad space factorI allow only values in the range 1..32767 here.I allow only nonnegative values here.Patterns can be loaded only by INIOMEGAhyphencharskewcharFONToffsetIllegal offset has been changed to 0The offset must be bigger than 0.naturaldir.onmatscaledImproper `at' size (pt), replaced by 10ptI can only handle fonts at positive sizes that areless than 2048pt, so I've changed what you said to 10pt.select font errorstopmodeopenincloseinmessageerrmessage(That was another \errmessage.)This error message was generated by an \errmessagecommand, so I can't give any explicit help.Pretend that you're Hercule Poirot: Examine all clues,and deduce the truth by order and method.lowercaseuppercaseshowshowboxshowtheshowlistsThis isn't an error message; I'm just \showing something.Type `I\show...' to show more (e.g., \show\cs,\showthe\count10, \showbox255, \showlists).And type `I\tracingonline=1\show...' to show boxes andlists on your terminal as well as in the transcript file.undefinedmacrolong macroouter macroouter endtemplate> \boxOK (see the transcript file) (INIOMEGA)You can't dump inside a group`{...\dump}' is a no-no. strings of total length memory locations dumped; current usage is preloaded font\font words of active ocps preloaded ocp\ocp\ocplist hyphenation exceptionHyphenation trie of length has op out of for language (format=format file nameBeginning to dump on file Transcript written on )end occurred inside a group at level when on line was incomplete)(see the transcript file for additional information)(\dump is performed only by INIOMEGA)debug # (-1 to exit):openoutcloseoutspecialimmediatesetlanguagelocalinterlinepenaltylocalbrokenpenaltypagedirbodydirpardirtextdirmathdirpageheightpagewidth[unknown extension!]ext1 (hyphenmin enddirbegindirwhatsit?ext2ext3endwritesystem()...clobberedexecuteddisabledUnbalanced write commandOn this page there's a \write with fewer real {'s than }'s.ext4output file name\openout = `whatsit=nullInputTranslationOutputTranslationDefaultInputTranslationDefaultOutputTranslationnoInputTranslationnoOutputTranslationnoDefaultInputTranslationnoDefaultOutputTranslationInputModeOutputModeDefaultInputModeDefaultOutputModenoInputModenoOutputModenoDefaultInputModenoDefaultOutputModecurrentfileonebyteebcdictwobytetwobyteLEInvalid input modeNull ocp being used: all input lostbad OCP program -- PC not validbad OCP program -- unknown instructionright hand side of OCP expression is badbad OCP program -- table index not validocpexternalocpocplistpushocplistpopocplistclearocplistsaddbeforeocplistaddafterocplistremovebeforeocplistremoveafterocplistocptracelevelselect ocp select ocp list To use ocps, use the primitiveTo use ocp lists, use the To build ocp lists, use the OCPOCPLISTNew active ocp list: {No active ocp lists to be poppedomega/home/plaice/soft/share/texmf/omega/plain/base//home/plaice/soft/share/texmf/omega/plain/base/omega.texomega.logOCPebcdicplain/home/plaice/soft/share/texmf/tex/plain/base//home/plaice/soft/share/texmf/tex/plain/base/plain.texactivedospecialsdo@netw@thr@@sixt@@n@cclv@cclvi@m@M@MMinsc@untallocationnumberm@newlogcount@dimen@dimen@idimen@iiskip@toks@newcountalloc@newdimennewskipnewmuskipnewboxnewtoksnewhelpnewreadnewwritenewfamnewlanguagech@cknewinsertmaxdimenhideskipcenteringp@z@z@skipvoidb@xnewif@ifif@smallskipamountmedskipamountbigskipamountnormalbaselineskipnormallineskipnormallineskiplimitjotinterdisplaylinepenaltyinterfootnotelinepenaltymagstephalfmagsteptenrmcmr10cmr/home/plaice/soft/share/texmf/omega/encodings/cmr.onmSGMLboldSGMLnoSGMLnamecmr&Gamma;micmr&Delta;micmr&Theta;micmr&Lambda;micmr&Xi;micmr&Pi;micmr&Sigma;micmr&Upsilon;micmr&Phi;micmr&Psi;micmr&Omega;micmrffmocmrfimocmrflmocmrffimocmrfflmocmr&#305;mocmr&MMLjdotless;mocmr&#768;mocmr&#769;mocmr&#780;mocmr&#774;mocmr&#772;mocmr&#778;mocmr&#807;mocmr&szlig;mocmr&aelig;mocmr&oelig;mocmr&oslash;mocmr&AElig;mocmr&OElig;mocmr&Oslash;mocmr&#823;mocmr!mocmr"mocmr#mocmr$mocmr%mocmr&amp;mocmr'mocmr(mocmr)mocmr*mocmr+mocmr,mocmr-mocmr.mocmr/mocmr0mncmr1mncmr2mncmr3mncmr4mncmr5mncmr6mncmr7mncmr8mncmr9mncmr:mocmr;mocmr&iexcl;mocmr=mocmr&iquest;mocmr?mocmr@mocmrAmicmrBmicmrCmicmrDmicmrEmicmrFmicmrGmicmrHmicmrImicmrJmicmrKmicmrLmicmrMmicmrNmicmrOmicmrPmicmrQmicmrRmicmrSmicmrTmicmrUmicmrVmicmrWmicmrXmicmrYmicmrZmicmr[mocmr"mocmr]mocmr&#770;mocmr&#775;mocmr`mocmramicmrbmicmrcmicmrdmicmremicmrfmicmrgmicmrhmicmrimicmrjmicmrkmicmrlmicmrmmicmrnmicmromicmrpmicmrqmicmrrmicmrsmicmrtmicmrumicmrvmicmrwmicmrxmicmrymicmrzmicmr&ndash;mocmr&mdash;mocmr&#779;mocmr&#771;mocmr&#776;mopreloadedcmr9cmrcmr8cmrsevenrmcmr7cmrcmr6cmrfivermcmr5cmrtenicmmi10cmmi/home/plaice/soft/share/texmf/omega/encodings/cmmi.onmcmmi&Gamma;micmmi&Delta;micmmi&Theta;micmmi&Lambda;micmmi&Xi;micmmi&Pi;micmmi&Sigma;micmmi&Upsilon;micmmi&Phi;micmmi&Psi;micmmi&Omega;micmmi&alpha;micmmi&beta;micmmi&gamma;micmmi&delta;micmmi&epsilon;micmmi&zeta;micmmi&eta;micmmi&theta;micmmi&iota;micmmi&kappa;micmmi&lambda;micmmi&mu;micmmi&nu;micmmi&xi;micmmi&pi;micmmi&rho;micmmi&sigma;micmmi&tau;micmmi&upsilon;micmmi&phi;micmmi&chi;micmmi&psi;micmmi&omega;micmmi&varepsilon;micmmi&vartheta;micmmi&varpi;micmmi&varrho;micmmi&varsigma;micmmi&varphi;micmmi&leftharpoonup;mocmmi&leftharpoondown;mocmmi&rightharpoonup;mocmmi&rightharpoondown;mocmmi&lhook;mocmmi&rhook;mocmmi&triangleright;mocmmi&triangleleft;mocmmi0mncmmi1mncmmi2mncmmi3mncmmi4mncmmi5mncmmi6mncmmi7mncmmi8mncmmi9mncmmi.mocmmi,mocmmi&lt;mocmmi/mocmmi&gt;mocmmi&star;mocmmi&partial;mocmmiAmicmmiBmicmmiCmicmmiDmicmmiEmicmmiFmicmmiGmicmmiHmicmmiImicmmiJmicmmiKmicmmiLmicmmiMmicmmiNmicmmiOmicmmiPmicmmiQmicmmiRmicmmiSmicmmiTmicmmiUmicmmiVmicmmiWmicmmiXmicmmiYmicmmiZmicmmi&flat;mocmmi&natural;mocmmi&sharp;mocmmi&smile;mocmmi&frown;mocmmi&ell;mocmmiamicmmibmicmmicmicmmidmicmmiemicmmifmicmmigmicmmihmicmmiimicmmijmicmmikmicmmilmicmmimmicmminmicmmiomicmmipmicmmiqmicmmirmicmmismicmmitmicmmiumicmmivmicmmiwmicmmixmicmmiymicmmizmicmmi&imath;mocmmi&jmath;mocmmi&wp;mocmmi&MMLvecaccent;mocmmi&MMLhataccent;mocmmi9cmmicmmi8cmmisevenicmmi7cmmicmmi6cmmifiveicmmi5cmmitensycmsy10cmsy/home/plaice/soft/share/texmf/omega/encodings/cmsy.onmcmsy-mocmsy&cdot;mocmsy&times;mocmsy&ast;mocmsy&div;mocmsy&diamond;mocmsy&pm;mocmsy&mp;mocmsy&oplus;mocmsy&ominus;mocmsy&otimes;mocmsy&oslash;mocmsy&odot;mocmsy&bigcirc;mocmsy&circ;mocmsy&bullet;mocmsy&asymp;mocmsy&equiv;mocmsy&subseteq;mocmsy&supseteq;mocmsy&leq;mocmsy&geq;mocmsy&preceq;mocmsy&succeq;mocmsy&sim;mocmsy&approx;mocmsy&subset;mocmsy&supset;mocmsy&ll;mocmsy&gg;mocmsy&prec;mocmsy&succ;mocmsy&leftarrow;mocmsy&rightarrow;mocmsy&uparrow;mocmsy&downarrow;mocmsy&leftrightarrow;mocmsy&nearrow;mocmsy&searrow;mocmsy&MMLsimeq;mocmsy&Leftarrow;mocmsy&Rightarrow;mocmsy&Uparrow;mocmsy&Downarrow;mocmsy&Leftrightarrow;mocmsy&nwarrow;mocmsy&swarrow;mocmsy&propto;mocmsy&prime;mocmsy&infty;mocmsy&in;mocmsy&ni;mocmsy&bigtriangleup;mocmsy&bigtriangledown;mocmsy/mocmsy&MMLshortmid;mocmsy&forall;mocmsy&exists;mocmsy&neg;mocmsy&emptyset;mocmsy&Re;mocmsy&Im;mocmsy&top;mocmsy&bot;mocmsy&aleph;mocmsy&Ascr;micmsy&Bscr;micmsy&Cscr;micmsy&Dscr;micmsy&Escr;micmsy&Fscr;micmsy&Gscr;micmsy&Hscr;micmsy&Iscr;micmsy&Jscr;micmsy&Kscr;micmsy&Lscr;micmsy&Mscr;micmsy&Nscr;micmsy&Oscr;micmsy&Pscr;micmsy&Qscr;micmsy&Rscr;micmsy&Sscr;micmsy&Tscr;micmsy&Uscr;micmsy&Vscr;micmsy&Wscr;micmsy&Xscr;micmsy&Yscr;micmsy&Zscr;micmsy&cup;mocmsy&cap;mocmsy&uplus;mocmsy&wedge;mocmsy&vee;mocmsy&vdash;mocmsy&dashv;mocmsy&lfloor;mocmsy&rfloor;mocmsy&lceil;mocmsy&rceil;mocmsy{mocmsy}mocmsy&langle;mocmsy&rangle;mocmsy&vert;mocmsy&Vert;mocmsy&updownarrow;mocmsy&Updownarrow;mocmsy&setminus;mocmsy&wr;mocmsy&surd;mocmsy&amalg;mocmsy&nabla;mocmsy&int;mocmsy&sqcup;mocmsy&sqcap;mocmsy&sqsubseteq;mocmsy&sqsupseteq;mocmsy&MMLS;mocmsy&dagger;mocmsy&ddagger;mocmsy&MMLP;mocmsy&clubsuit;mocmsy&diamondsuit;mocmsy&heartsuit;mocmsy&spadesuit;mocmsy9cmsycmsy8cmsysevensycmsy7cmsycmsy6cmsyfivesycmsy5cmsytenexcmex10cmex/home/plaice/soft/share/texmf/omega/encodings/cmex.onmcmex(mocmex)mocmex[mocmex]mocmex&lfloor;mocmex&rfloor;mocmex&lceil;mocmex&rceil;mocmex{mocmex}mocmex&langle;mocmex&rangle;mocmex&MMLpart;merrorcmex&MMLpart;merrorcmex&MMLpart;merrorcmex&MMLpart;merrorcmex(mocmex)mocmex(mocmex)mocmex[mocmex]mocmex&lfloor;mocmex&rfloor;mocmex&lceil;mocmex&rceil;mocmex{mocmex}mocmex&langle;mocmex&rangle;mocmex&MMLpart;merrorcmex&MMLpart;merrorcmex(mocmex)mocmex[mocmex]mocmex&lfloor;mocmex&rfloor;mocmex&lceil;mocmex&rceil;mocmex{mocmex}mocmex&langle;mocmex&rangle;mocmex&MMLpart;merrorcmex&MMLpart;merrorcmex&MMLpart;merrorcmex&MMLpart;merrorcmex&MMLpart;merrorcmex&MMLpart;merrorcmex&MMLpart;merrorcmex&MMLpart;merrorcmex&MMLpart;merrorcmex&MMLpart;merrorcmex&MMLpart;merrorcmex&MMLpart;merrorcmex&MMLpart;merrorcmex&MMLpart;merrorcmex&MMLpart;merrorcmex&MMLpart;merrorcmex&MMLpart;merrorcmex&MMLpart;merrorcmex&MMLpart;merrorcmex&MMLpart;merrorcmex&MMLpart;merrorcmex&MMLpart;merrorcmex&MMLpart;merrorcmex&MMLpart;merrorcmex&langle;mocmex&rangle;mocmex&sqcup;mocmex&sqcup;mocmex&oint;mocmex&oint;mocmex&odot;mocmex&odot;mocmex&oplus;mocmex&oplus;mocmex&otimes;mocmex&otimes;mocmex&sum;mocmex&prod;mocmex&int;mocmex&cup;mocmex&cap;mocmex&uplus;mocmex&wedge;mocmex&vee;mocmex&sum;mocmex&prod;mocmex&int;mocmex&cup;mocmex&cap;mocmex&uplus;mocmex&wedge;mocmex&vee;mocmex&coprod;mocmex&coprod;mocmex&hat;mocmex&hat;mocmex&hat;mocmex&tilde;mocmex&tilde;mocmex&tilde;mocmex[mocmex]mocmex&lfloor;mocmex&rfloor;mocmex&lceil;mocmex&rceil;mocmex{mocmex}mocmex&surd;mocmex&surd;mocmex&surd;mocmex&surd;mocmex&surd;mocmex&MMLpart;merrorcmex&MMLpart;merrorcmex&MMLpart;merrorcmex&MMLpart;merrorcmex&MMLpart;merrorcmex&MMLpart;merrorcmex&MMLpart;merrorcmex&MMLpart;merrorcmex&MMLpart;merrorcmex&MMLpart;merrorcmex&MMLpart;merrorcmss10cmsscmssq8cmssqcmssi10cmssicmssqi8cmssqitenbfcmbx10cmbx/home/plaice/soft/share/texmf/omega/encodings/cmbx.onmcmbx&Gamma;mifontweightboldcmbx&Delta;mifontweightboldcmbx&Theta;mifontweightboldcmbx&Lambda;mifontweightboldcmbx&Xi;mifontweightboldcmbx&Pi;mifontweightboldcmbx&Sigma;mifontweightboldcmbx&Upsilon;mifontweightboldcmbx&Phi;mifontweightboldcmbx&Psi;mifontweightboldcmbx&Omega;mifontweightboldcmbx&#64256;mofontweightboldcmbx&#64257;mofontweightboldcmbx&#64258;mofontweightboldcmbx&#64259;mofontweightboldcmbx&#64260;mofontweightboldcmbx&#305;mofontweightboldcmbx&MMLjdotless;mofontweightboldcmbx&#768;mofontweightboldcmbx&#769;mofontweightboldcmbx&#780;mofontweightboldcmbx&#774;mofontweightboldcmbx&#772;mofontweightboldcmbx&#778;mofontweightboldcmbx&#807;mofontweightboldcmbx&szlig;mofontweightboldcmbx&aelig;mofontweightboldcmbx&oelig;mofontweightboldcmbx&oslash;mofontweightboldcmbx&AElig;mofontweightboldcmbx&OElig;mofontweightboldcmbx&Oslash;mofontweightboldcmbx&#823;mofontweightboldcmbx!mofontweightboldcmbx&rdquo;mofontweightboldcmbx#mofontweightboldcmbx$mofontweightboldcmbx%mofontweightboldcmbx&amp;mofontweightboldcmbx&rsquo;mofontweightboldcmbx(mofontweightboldcmbx)mofontweightboldcmbx*mofontweightboldcmbx+mofontweightboldcmbx,mofontweightboldcmbx-mofontweightboldcmbx.mofontweightboldcmbx/mofontweightboldcmbx0mnfontweightboldcmbx1mnfontweightboldcmbx2mnfontweightboldcmbx3mnfontweightboldcmbx4mnfontweightboldcmbx5mnfontweightboldcmbx6mnfontweightboldcmbx7mnfontweightboldcmbx8mnfontweightboldcmbx9mnfontweightboldcmbx:mofontweightboldcmbx;mofontweightboldcmbx&iexcl;mofontweightboldcmbx=mofontweightboldcmbx&iquest;mofontweightboldcmbx?mofontweightboldcmbx@mofontweightboldcmbxAmifontweightboldcmbxBmifontweightboldcmbxCmifontweightboldcmbxDmifontweightboldcmbxEmifontweightboldcmbxFmifontweightboldcmbxGmifontweightboldcmbxHmifontweightboldcmbxImifontweightboldcmbxJmifontweightboldcmbxKmifontweightboldcmbxLmifontweightboldcmbxMmifontweightboldcmbxNmifontweightboldcmbxOmifontweightboldcmbxPmifontweightboldcmbxQmifontweightboldcmbxRmifontweightboldcmbxSmifontweightboldcmbxTmifontweightboldcmbxUmifontweightboldcmbxVmifontweightboldcmbxWmifontweightboldcmbxXmifontweightboldcmbxYmifontweightboldcmbxZmifontweightboldcmbx[mofontweightboldcmbx&ldquo;mofontweightboldcmbx]mofontweightboldcmbx&#770;mofontweightboldcmbx&#775;mofontweightboldcmbx&lsquo;mofontweightboldcmbxamifontweightboldcmbxbmifontweightboldcmbxcmifontweightboldcmbxdmifontweightboldcmbxemifontweightboldcmbxfmifontweightboldcmbxgmifontweightboldcmbxhmifontweightboldcmbximifontweightboldcmbxjmifontweightboldcmbxkmifontweightboldcmbxlmifontweightboldcmbxmmifontweightboldcmbxnmifontweightboldcmbxomifontweightboldcmbxpmifontweightboldcmbxqmifontweightboldcmbxrmifontweightboldcmbxsmifontweightboldcmbxtmifontweightboldcmbxumifontweightboldcmbxvmifontweightboldcmbxwmifontweightboldcmbxxmifontweightboldcmbxymifontweightboldcmbxzmifontweightboldcmbx&ndash;mofontweightboldcmbx&mdash;mofontweightboldcmbx&#779;mofontweightboldcmbx&#771;mofontweightboldcmbx&#776;mofontweightboldcmbx9cmbxcmbx8cmbxsevenbfcmbx7cmbxcmbx6cmbxfivebfcmbx5cmbxtenttcmtt10cmtt/home/plaice/soft/share/texmf/omega/encodings/cmtt.onmcmtt&Gamma;micmtt&Delta;micmtt&Theta;micmtt&Lambda;micmtt&Xi;micmtt&Pi;micmtt&Sigma;micmtt&Upsilon;micmtt&Phi;micmtt&Psi;micmtt&Omega;micmtt&uarr;mocmtt&darr;mocmtt'mocmtt&iexcl;mocmtt&iquest;mocmtt&#305;mocmtt&MMLjdotless;mocmtt&#768;mocmtt&#769;mocmtt&#780;mocmtt&#774;mocmtt&#772;mocmtt&#778;mocmtt&#807;mocmtt&szlig;mocmtt&aelig;mocmtt&oelig;mocmtt&oslash;mocmtt&AElig;mocmtt&OElig;mocmtt&Oslash;mocmtt&#9251;mocmtt!mocmtt"mocmtt#mocmtt$mocmtt%mocmtt&amp;mocmtt&rsquo;mocmtt(mocmtt)mocmtt*mocmtt+mocmtt,mocmtt-mocmtt.mocmtt/mocmtt0mncmtt1mncmtt2mncmtt3mncmtt4mncmtt5mncmtt6mncmtt7mncmtt8mncmtt9mncmtt:mocmtt;mocmtt&lt;mocmtt=mocmtt&gt;mocmtt?mocmtt@mocmttAmicmttBmicmttCmicmttDmicmttEmicmttFmicmttGmicmttHmicmttImicmttJmicmttKmicmttLmicmttMmicmttNmicmttOmicmttPmicmttQmicmttRmicmttSmicmttTmicmttUmicmttVmicmttWmicmttXmicmttYmicmttZmicmtt[mocmtt\mocmtt]mocmtt&#770;mocmtt_mocmtt&lsquo;mocmttamicmttbmicmttcmicmttdmicmttemicmttfmicmttgmicmtthmicmttimicmttjmicmttkmicmttlmicmttmmicmttnmicmttomicmttpmicmttqmicmttrmicmttsmicmtttmicmttumicmttvmicmttwmicmttxmicmttymicmttzmicmtt{mocmtt|mocmtt}mocmtt&#771;mocmtt&#776;mocmtt9cmttcmtt8cmttcmsltt10cmsltttenslcmsl10cmsl/home/plaice/soft/share/texmf/omega/encodings/cmsl.onmcmsl&Gamma;micmsl&Delta;micmsl&Theta;micmsl&Lambda;micmsl&Xi;micmsl&Pi;micmsl&Sigma;micmsl&Upsilon;micmsl&Phi;micmsl&Psi;micmsl&Omega;micmsl&#64256;mocmsl&#64257;mocmsl&#64258;mocmsl&#64259;mocmsl&#64260;mocmsl&#305;mocmsl&MMLjdotless;mocmsl&#768;mocmsl&#769;mocmsl&#780;mocmsl&#774;mocmsl&#772;mocmsl&#778;mocmsl&#807;mocmsl&szlig;mocmsl&aelig;mocmsl&oelig;mocmsl&oslash;mocmsl&AElig;mocmsl&OElig;mocmsl&Oslash;mocmsl&#823;mocmsl!mocmsl&rdquo;mocmsl#mocmsl$mocmsl%mocmsl&amp;mocmsl&rsquo;mocmsl(mocmsl)mocmsl*mocmsl+mocmsl,mocmsl-mocmsl.mocmsl/mocmsl0mncmsl1mncmsl2mncmsl3mncmsl4mncmsl5mncmsl6mncmsl7mncmsl8mncmsl9mncmsl:mocmsl;mocmsl&iexcl;mocmsl=mocmsl&iquest;mocmsl?mocmsl@mocmslAmicmslBmicmslCmicmslDmicmslEmicmslFmicmslGmicmslHmicmslImicmslJmicmslKmicmslLmicmslMmicmslNmicmslOmicmslPmicmslQmicmslRmicmslSmicmslTmicmslUmicmslVmicmslWmicmslXmicmslYmicmslZmicmsl[mocmsl&ldquo;mocmsl]mocmsl&#770;mocmsl&#775;mocmsl&lsquo;mocmslamicmslbmicmslcmicmsldmicmslemicmslfmicmslgmicmslhmicmslimicmsljmicmslkmicmsllmicmslmmicmslnmicmslomicmslpmicmslqmicmslrmicmslsmicmsltmicmslumicmslvmicmslwmicmslxmicmslymicmslzmicmsl&ndash;mocmsl&mdash;mocmsl&#779;mocmsl&#771;mocmsl&#776;mocmsl9cmslcmsl8cmsltenitcmti10cmti/home/plaice/soft/share/texmf/omega/encodings/cmti.onmcmti&Gamma;micmti&Delta;micmti&Theta;micmti&Lambda;micmti&Xi;micmti&Pi;micmti&Sigma;micmti&Upsilon;micmti&Phi;micmti&Psi;micmti&Omega;micmti&#64256;mocmti&#64257;mocmti&#64258;mocmti&#64259;mocmti&#64260;mocmti&#305;mocmti&MMLjdotless;mocmti&#768;mocmti&#769;mocmti&#780;mocmti&#774;mocmti&#772;mocmti&#778;mocmti&#807;mocmti&szlig;mocmti&aelig;mocmti&oelig;mocmti&oslash;mocmti&AElig;mocmti&OElig;mocmti&Oslash;mocmti&#823;mocmti!mocmti&rdquo;mocmti#mocmti&pound;mocmti%mocmti&amp;mocmti&rsquo;mocmti(mocmti)mocmti*mocmti+mocmti,mocmti-mocmti.mocmti/mocmti0mncmti1mncmti2mncmti3mncmti4mncmti5mncmti6mncmti7mncmti8mncmti9mncmti:mocmti;mocmti&iexcl;mocmti=mocmti&iquest;mocmti?mocmti@mocmtiAmicmtiBmicmtiCmicmtiDmicmtiEmicmtiFmicmtiGmicmtiHmicmtiImicmtiJmicmtiKmicmtiLmicmtiMmicmtiNmicmtiOmicmtiPmicmtiQmicmtiRmicmtiSmicmtiTmicmtiUmicmtiVmicmtiWmicmtiXmicmtiYmicmtiZmicmti[mocmti&ldquo;mocmti]mocmti&#770;mocmti&#775;mocmti&lsquo;mocmtiamicmtibmicmticmicmtidmicmtiemicmtifmicmtigmicmtihmicmtiimicmtijmicmtikmicmtilmicmtimmicmtinmicmtiomicmtipmicmtiqmicmtirmicmtismicmtitmicmtiumicmtivmicmtiwmicmtixmicmtiymicmtizmicmti&ndash;mocmti&mdash;mocmti&#779;mocmti&#771;mocmti&#776;mocmti9cmticmti8cmticmti7cmticmu10cmucmmib10cmmib/home/plaice/soft/share/texmf/omega/encodings/cmmib.onmcmmib&Gamma;mifontweightboldcmmib&Delta;mifontweightboldcmmib&Theta;mifontweightboldcmmib&Lambda;mifontweightboldcmmib&Xi;mifontweightboldcmmib&Pi;mifontweightboldcmmib&Sigma;mifontweightboldcmmib&Upsilon;mifontweightboldcmmib&Phi;mifontweightboldcmmib&Psi;mifontweightboldcmmib&Omega;mifontweightboldcmmib&alpha;mifontweightboldcmmib&beta;mifontweightboldcmmib&gamma;mifontweightboldcmmib&delta;mifontweightboldcmmib&epsilon;mifontweightboldcmmib&zeta;mifontweightboldcmmib&eta;mifontweightboldcmmib&theta;mifontweightboldcmmib&iota;mifontweightboldcmmib&kappa;mifontweightboldcmmib&lambda;mifontweightboldcmmib&mu;mifontweightboldcmmib&nu;mifontweightboldcmmib&xi;mifontweightboldcmmib&pi;mifontweightboldcmmib&rho;mifontweightboldcmmib&sigma;mifontweightboldcmmib&tau;mifontweightboldcmmib&upsilon;mifontweightboldcmmib&phi;mifontweightboldcmmib&chi;mifontweightboldcmmib&psi;mifontweightboldcmmib&omega;mifontweightboldcmmib&varepsilon;mifontweightboldcmmib&vartheta;mifontweightboldcmmib&varpi;mifontweightboldcmmib&varrho;mifontweightboldcmmib&varsigma;mifontweightboldcmmib&varphi;mifontweightboldcmmib&leftharpoonup;mofontweightboldcmmib&leftharpoondown;mofontweightboldcmmib&rightharpoonup;mofontweightboldcmmib&rightharpoondown;mofontweightboldcmmib&MMLlefthook;mofontweightboldcmmib&MMLrighthook;mofontweightboldcmmib&triangleright;mofontweightboldcmmib&triangleleft;mofontweightboldcmmib0mnfontweightboldcmmib1mnfontweightboldcmmib2mnfontweightboldcmmib3mnfontweightboldcmmib4mnfontweightboldcmmib5mnfontweightboldcmmib6mnfontweightboldcmmib7mnfontweightboldcmmib8mnfontweightboldcmmib9mnfontweightboldcmmib.mofontweightboldcmmib,mofontweightboldcmmib&lt;mofontweightboldcmmib/mofontweightboldcmmib&gt;mofontweightboldcmmib&star;mofontweightboldcmmib&partial;mofontweightboldcmmibAmifontweightboldcmmibBmifontweightboldcmmibCmifontweightboldcmmibDmifontweightboldcmmibEmifontweightboldcmmibFmifontweightboldcmmibGmifontweightboldcmmibHmifontweightboldcmmibImifontweightboldcmmibJmifontweightboldcmmibKmifontweightboldcmmibLmifontweightboldcmmibMmifontweightboldcmmibNmifontweightboldcmmibOmifontweightboldcmmibPmifontweightboldcmmibQmifontweightboldcmmibRmifontweightboldcmmibSmifontweightboldcmmibTmifontweightboldcmmibUmifontweightboldcmmibVmifontweightboldcmmibWmifontweightboldcmmibXmifontweightboldcmmibYmifontweightboldcmmibZmifontweightboldcmmib&flat;mofontweightboldcmmib&natural;mofontweightboldcmmib&sharp;mofontweightboldcmmib&smile;mofontweightboldcmmib&frown;mofontweightboldcmmib&ell;mofontweightboldcmmibamifontweightboldcmmibbmifontweightboldcmmibcmifontweightboldcmmibdmifontweightboldcmmibemifontweightboldcmmibfmifontweightboldcmmibgmifontweightboldcmmibhmifontweightboldcmmibimifontweightboldcmmibjmifontweightboldcmmibkmifontweightboldcmmiblmifontweightboldcmmibmmifontweightboldcmmibnmifontweightboldcmmibomifontweightboldcmmibpmifontweightboldcmmibqmifontweightboldcmmibrmifontweightboldcmmibsmifontweightboldcmmibtmifontweightboldcmmibumifontweightboldcmmibvmifontweightboldcmmibwmifontweightboldcmmibxmifontweightboldcmmibymifontweightboldcmmibzmifontweightboldcmmib&imath;mofontweightboldcmmib&jmath;mofontweightboldcmmib&wp;mofontweightboldcmmib&MMLvecaccent;mofontweightboldcmmib&MMLhataccent;mofontweightboldcmbsy10cmbsy/home/plaice/soft/share/texmf/omega/encodings/cmbsy.onmcmbsy-mofontweightboldcmbsy&cdot;mofontweightboldcmbsy&times;mofontweightboldcmbsy&ast;mofontweightboldcmbsy&div;mofontweightboldcmbsy&diamond;mofontweightboldcmbsy&pm;mofontweightboldcmbsy&mp;mofontweightboldcmbsy&oplus;mofontweightboldcmbsy&ominus;mofontweightboldcmbsy&otimes;mofontweightboldcmbsy&oslash;mofontweightboldcmbsy&odot;mofontweightboldcmbsy&bigcirc;mofontweightboldcmbsy&circ;mofontweightboldcmbsy&bullet;mofontweightboldcmbsy&asymp;mofontweightboldcmbsy&equiv;mofontweightboldcmbsy&subseteq;mofontweightboldcmbsy&supseteq;mofontweightboldcmbsy&leq;mofontweightboldcmbsy&geq;mofontweightboldcmbsy&preceq;mofontweightboldcmbsy&succeq;mofontweightboldcmbsy&sim;mofontweightboldcmbsy&approx;mofontweightboldcmbsy&subset;mofontweightboldcmbsy&supset;mofontweightboldcmbsy&ll;mofontweightboldcmbsy&gg;mofontweightboldcmbsy&prec;mofontweightboldcmbsy&succ;mofontweightboldcmbsy&leftarrow;mofontweightboldcmbsy&rightarrow;mofontweightboldcmbsy&uparrow;mofontweightboldcmbsy&downarrow;mofontweightboldcmbsy&leftrightarrow;mofontweightboldcmbsy&nearrow;mofontweightboldcmbsy&searrow;mofontweightboldcmbsy&MMLsimeq;mofontweightboldcmbsy&Leftarrow;mofontweightboldcmbsy&Rightarrow;mofontweightboldcmbsy&Uparrow;mofontweightboldcmbsy&Downarrow;mofontweightboldcmbsy&Leftrightarrow;mofontweightboldcmbsy&nwarrow;mofontweightboldcmbsy&swarrow;mofontweightboldcmbsy&propto;mofontweightboldcmbsy&prime;mofontweightboldcmbsy&infty;mofontweightboldcmbsy&in;mofontweightboldcmbsy&ni;mofontweightboldcmbsy&bigtriangleup;mofontweightboldcmbsy&bigtriangledown;mofontweightboldcmbsy/mofontweightboldcmbsy&MMLshortmid;mofontweightboldcmbsy&forall;mofontweightboldcmbsy&exists;mofontweightboldcmbsy&neg;mofontweightboldcmbsy&emptyset;mofontweightboldcmbsy&Re;mofontweightboldcmbsy&Im;mofontweightboldcmbsy&top;mofontweightboldcmbsy&bot;mofontweightboldcmbsy&aleph;mofontweightboldcmbsy&Ascr;mifontweightboldcmbsy&Bscr;mifontweightboldcmbsy&Cscr;mifontweightboldcmbsy&Dscr;mifontweightboldcmbsy&Escr;mifontweightboldcmbsy&Fscr;mifontweightboldcmbsy&Gscr;mifontweightboldcmbsy&Hscr;mifontweightboldcmbsy&Iscr;mifontweightboldcmbsy&Jscr;mifontweightboldcmbsy&Kscr;mifontweightboldcmbsy&Lscr;mifontweightboldcmbsy&Mscr;mifontweightboldcmbsy&Nscr;mifontweightboldcmbsy&Oscr;mifontweightboldcmbsy&Pscr;mifontweightboldcmbsy&Qscr;mifontweightboldcmbsy&Rscr;mifontweightboldcmbsy&Sscr;mifontweightboldcmbsy&Tscr;mifontweightboldcmbsy&Uscr;mifontweightboldcmbsy&Vscr;mifontweightboldcmbsy&Wscr;mifontweightboldcmbsy&Xscr;mifontweightboldcmbsy&Yscr;mifontweightboldcmbsy&Zscr;mifontweightboldcmbsy&cup;mofontweightboldcmbsy&cap;mofontweightboldcmbsy&uplus;mofontweightboldcmbsy&wedge;mofontweightboldcmbsy&vee;mofontweightboldcmbsy&vdash;mofontweightboldcmbsy&dashv;mofontweightboldcmbsy&lfloor;mofontweightboldcmbsy&rfloor;mofontweightboldcmbsy&lceil;mofontweightboldcmbsy&rceil;mofontweightboldcmbsy{mofontweightboldcmbsy}mofontweightboldcmbsy&langle;mofontweightboldcmbsy&rangle;mofontweightboldcmbsy&vert;mofontweightboldcmbsy&Vert;mofontweightboldcmbsy&updownarrow;mofontweightboldcmbsy&Updownarrow;mofontweightboldcmbsy&setminus;mofontweightboldcmbsy&wr;mofontweightboldcmbsy&surd;mofontweightboldcmbsy&amalg;mofontweightboldcmbsy&nabla;mofontweightboldcmbsy&int;mofontweightboldcmbsy&sqcup;mofontweightboldcmbsy&sqcap;mofontweightboldcmbsy&sqsubseteq;mofontweightboldcmbsy&sqsupseteq;mofontweightboldcmbsy&MMLS;mofontweightboldcmbsy&dagger;mofontweightboldcmbsy&ddagger;mofontweightboldcmbsy&MMLP;mofontweightboldcmbsy&clubsuit;mofontweightboldcmbsy&diamondsuit;mofontweightboldcmbsy&heartsuit;mofontweightboldcmbsy&spadesuit;mofontweightboldcmcsc10cmcsc/home/plaice/soft/share/texmf/omega/encodings/cmcsc.onmcmcsc&Gamma;micmcsc&Delta;micmcsc&Theta;micmcsc&Lambda;micmcsc&Xi;micmcsc&Pi;micmcsc&Sigma;micmcsc&Upsilon;micmcsc&Phi;micmcsc&Psi;micmcsc&Omega;micmcsc&uarr;mocmcsc&darr;mocmcsc'mocmcsc&iexcl;mocmcsc&iquest;mocmcsc&#305;mocmcsc&MMLjdotless;mocmcsc&#768;mocmcsc&#769;mocmcsc&#780;mocmcsc&#774;mocmcsc&#772;mocmcsc&#778;mocmcsc&#807;mocmcsc&szlig;mocmcsc&aelig;mocmcsc&oelig;mocmcsc&oslash;mocmcsc&AElig;mocmcsc&OElig;mocmcsc&Oslash;mocmcsc&#823;mocmcsc!mocmcsc&rdquo;mocmcsc#mocmcsc$mocmcsc%mocmcsc&amp;mocmcsc&rsquo;mocmcsc(mocmcsc)mocmcsc*mocmcsc+mocmcsc,mocmcsc-mocmcsc.mocmcsc/mocmcsc0mncmcsc1mncmcsc2mncmcsc3mncmcsc4mncmcsc5mncmcsc6mncmcsc7mncmcsc8mncmcsc9mncmcsc:mocmcsc;mocmcsc&lt;mocmcsc=mocmcsc&gt;mocmcsc?mocmcsc@mocmcscAmicmcscBmicmcscCmicmcscDmicmcscEmicmcscFmicmcscGmicmcscHmicmcscImicmcscJmicmcscKmicmcscLmicmcscMmicmcscNmicmcscOmicmcscPmicmcscQmicmcscRmicmcscSmicmcscTmicmcscUmicmcscVmicmcscWmicmcscXmicmcscYmicmcscZmicmcsc[mocmcsc&ldquo;mocmcsc]mocmcsc&#770;mocmcsc&#775;mocmcsc&lsquo;mocmcscamicmcscbmicmcsccmicmcscdmicmcscemicmcscfmicmcscgmicmcschmicmcscimicmcscjmicmcsckmicmcsclmicmcscmmicmcscnmicmcscomicmcscpmicmcscqmicmcscrmicmcscsmicmcsctmicmcscumicmcscvmicmcscwmicmcscxmicmcscymicmcsczmicmcsc&ndash;mocmcsc&mdash;mocmcsc&#779;mocmcsc&#771;mocmcsc&#776;mocmssbx10cmssbxcmdunh10cmdunhcmrcmttcmssbxmanfntmanfntundefinedrmmitoldstylecalitfamitslfamslbffambfttfamttfrenchspacingnonfrenchspacingnormalbaselineslqrqlbrackrbrackendgrafendlinespaceemptynullbgroupegroupobeylinesobeyspaceslooprepeatbodyiteratenextthinspacenegthinspaceenspaceenskipquadqquadsmallskipmedskipbigskipnointerlineskipoffinterlineskiptopgluevgluevgl@nobreakhgluehgl@leavevmodeslashbreakallowbreakfilbreakgoodbreakejectsuperejectremovelastskipsmallbreakmedbreakbigbreaklineleftlinerightlinecenterlinerlapllapm@thunderbarstrutboxstruthidewidthialignmscountmultispansp@nifus@us@trueus@falseif@cr@crtrue@crfalsetabstabsyettabsdonecleartabssettabssett@bnxts@tt@bs@tcolsm@ketabboxtabaligncolumns@nothert@bboxt@bb@xhangtextindentitemitemitemnarrowerbeginsectionproclaimraggedrightttraggedrightssaeoeAEOEaaAAmathhexboxdagddagOrboaligno@lignooaligngetf@ctorsh@ftcopyrightdotsldotsTeXhrulefilldotfillrightarrowfillsmashrightarrowleftarrowfillleftarrowbraceldbracerdbracelubracerudownbracefillupbracefillbyespsbprim@sprimepr@m@spr@@@spr@@@tnotalphabetagammadeltaepsilonzetaetathetaiotakappalambdamunuxipirhosigmatauupsilonphichipsiomegavarepsilonvarthetavarpivarrhovarsigmavarphiGammaDeltaThetaLambdaXiPiSigmaUpsilonPhiPsiOmegaalephhbarimathjmathellwpReImpartialinftyemptysetnablasurdtopbotangletriangleforallexistsneglnotflatnaturalsharpclubsuitdiamondsuitheartsuitspadesuitcoprodbigveebigwedgebiguplusbigcapbigcupintopintprodsumbigotimesbigoplusbigodotointopointbigsqcupsmallinttrianglelefttrianglerightbigtriangleupbigtriangledownwedgelandveelorcapcupddaggerdaggersqcapsqcupuplusamalgdiamondbulletwrdivodotoslashotimesominusoplusmppmcircbigcircsetminuscdotasttimesstarproptosqsubseteqsqsupseteqparallelmiddashvvdashnearrowsearrownwarrowswarrowLeftrightarrowLeftarrowRightarrowneqneleqlegeqgesuccprecapproxsucceqpreceqsupsetsubsetsupseteqsubseteqinniownsggllleftrightarrowgetstomapstocharmapstosimsimeqperpequivasympsmilefrownleftharpoonupleftharpoondownrightharpoonuprightharpoondownjoinrelrelbarRelbarlhookhookrightarrowrhookhookleftarrowbowtiemodelsLongrightarrowlongrightarrowlongleftarrowLongleftarrowlongmapstolongleftrightarrowLongleftrightarrowiffldotpcdotpcoloncdotsvdotsddotsacutegraveddottildebarbrevecheckhatvecdotwidetildewidehatoverrightarrowoverleftarrowoverbraceunderbraceskewlmoustachermoustachelgrouprgrouparrowvertArrowvertbracevertVertvertuparrowdownarrowupdownarrowUparrowDownarrowUpdownarrowbackslashranglelanglerbracelbracerceillceilrfloorlfloorbiglbigbigmbigrBiglBigBigmBigrbigglbiggbiggmbiggrBigglBiggBiggmBiggrn@spacechoosebrackbracesqrtmathpaletterootboxrootofr@@tifv@v@truev@falseifh@h@trueh@falsevphantomph@nthphantomphantommathph@ntmakeph@ntfinph@ntmathstrutmathsm@shmakesm@shfinsm@shcong@vereqnotinc@ncelrightleftharpoonsrlh@buildreldoteqloglglnlimlimsupliminfsinarcsinsinhcosarccoscoshtanarctantanhcotcothseccscmaxminsupinfargkerdimhomdetexpPrgcddegbmodpmodcasesmatrixpmatrixp@renwdbordermatrixopenup@penupeqalignifdt@pdt@ptruedt@pfalsedispl@y@ligndisplaylineseqalignnoleqalignnopagenoheadlinefootlinefolioifr@ggedbottomr@ggedbottomtruer@ggedbottomfalseraggedbottomnormalbottomnopagenumbersadvancepagenofootinsfootnote@sfvfootnotefootstrutfo@tf@@tf@t@foottopinsifp@gep@getruep@gefalseif@mid@midtrue@midfalsetopinsert@insmidinsertpageinsertendinsertplainoutputmakeheadlinepagebodymakefootlinedosuperejectpagecontentsfootnoterulehyphen/home/plaice/soft/share/texmf/tex/generic/hyphen//home/plaice/soft/share/texmf/tex/generic/hyphen/hyphen.texassociateassociatesdeclinationobligatoryphilanthropicpresentpresentsprojectprojectsreciprocityrecognizancereformationretributiontablemagnificationm@gtracingallshowhyphensfmtnamefmtversion (format=omega 2000.8.13)T ( dXY  L    MTN9:  d    ST  |          NO      abWX   z {  IJ   u v  T   p q  $DE    k l { |HI45 v w$ f g q rT?@ l m< a b g h b cT \ ] ] ^:; X Yl W X S T?4 N O R S I J56 D E M N ? @   : ; H I 5 601 0 1 C D + ,pTq/0 & ' > ? ! "+,   9 :  D   4 5  ,&'    / 0  fgCD  !D" * +  t  \ % &  *+  t  !  {|      \]RS        vw         4        qr         >?%&        l4m           4     gdh   L     ?Tuv   d     bc | } |    w x4 r s     m n]^ h i     c dkl ! ^ _d   Y Z4         ?4??( ?4 ?@(?L4?X@?dL?|X|?d?|????????? ??0 H?H`?`0zx{?xHuv?`|}pqwx?xrsklmn?hifgcd?^_abYZ?TU\]OP?JKW XEF? @AR8S;<?867MPN{|12?P ,-HhIvw'(?h8"#CDqr?P>?lm?h9:gh  ?45bc?/0]^?*+XY?%&ST? (!NO?(@IJ?@XDE?X(p?@?p@  :;?X56?p01?+,?T&'?T4!"z{. 6. 2/ 90 51 12 43 14 .5 367 n9 i: a; l< p=>}@A B 0C(AD 0Ee>FGHI%4J rKj5L MN*O{PQ 0R/ST #UaWj5X(AYj5Z[B\{]B^/_`SaBbcBdUeBf)gh*ijuMkBlTmn np iq er us rt tu 8v4w ux ny iz e{ u| r} t~ 9 . 8  n i e u r t 5 . 6 (! 6 . 2  n i e u r t 2  h t d i w "! 3 -6) -644 $4#  9 =)6$#6 y58g -}{F5 >QA }j&{F5r! 4 2V~o}2}e}{! 5 . 8 o t{F! 5 . 2 2 - {5 o t} #!j9"\#{$ % o& t'()6+,$-. -/ >01 263}45i~67{896:;@{}=>gA6B}C6D2E5F5GH$I}J)K -LM5NO{P Q oR tST5U9V)W4X5Y7Zj5[vI\]>o^ _ 0` 0a 1b5c{def$gdh5ij2kkl6m6nopiq >r)s t}u -v)w2 xԗy)z2 {!| 2} 1~)2 59)2 5E)kW5/8ka =kUX3d =3d =4 =48}{>o o t  #iWi6i$%iim%W iWշ}{ 9hi7r  #}{ M6/} M M9vIrE W4{>o  M3 M #6B(2 $(2  5! <"(# $%}'({)j&*+8!- 0. 1/8g01A <3(4 56!M pH$:(ILP u6R(@5GB?(K 13dF =DC9!J 0E8g> l\T 6O sX =; -N!S 0QUZ8=V\ [ r_]a}bcdefg}h$i#j Ak$l{mno -pq&rHstu$v}w#x}y{z{{| A}$~&$}#{ A${ o tQH3z #}}$# A${C&H$}#}{{ A$&$}#{ A${ o tQH3z #}}$# A${ o t{Q3z #}{4}}65$6 r - ! 0 0 0 1a{5{ - > d4 d 3d = a = a8,}}$}#}{{ !$"&#$$}%#&{'($)* +{,q-./0{162,345 #6)8r92 :);V~<2 =)>j?2 @A =C)D;E(FGgI}JKLBMENO{PQ;RS}T$U )V IW,X}YV~Z -[\5]^B_E` -ab{c6d}e!f 2ghBij{klBm/noBpSq -rs (t5u1Sv -wxBySz{$|{}~/}4B/B{/}4B/58{/}} s}V~ -{5 s$#$&&$#$#${q}! 2{5}&1S!$3 2{{5/ #B ) I}{c (5 #,}}}V~ -{5w }V~ -{5w$#$&&$# $  { q {6, # . I}}# &!$"##$$%{&q'(){*6+,,{-5./ #0 )23,4,5}6 d7 o8 m9R:{; (< u= m> 8? 1@ AsBC #DF -G WHzI uJ mK 5L M 0N 0O 9P5Q}R dS oT mURV{W4X Y uZ m[ 5\ ]^ -_ W`zabm8d}e gf eg dhRi{j?kl}n do cp gqRr{s?tu}w rx PyRz{{?|}m8} p x eR{?} t e dR{?m8} m o hR{?m8} m i dR{?m8} r e kR{?m8} g r aR{?} f n iR{?} p u sR{?} n i mR{?} x a mR{?m8} c s cR{?m8} c e sR{?m8} h t o cR{?m8} t o cR{?m8} h n a t R {?m8} n a t c r aR{?m8} n! a" t#R${%?&'m8)}* h+ s, o- c.R/{0?12m84}5 s6 o7 c8 c9 r: a;R<{=?>?m8A}B sC oD cERF{G?HIm8K}L hM nN iO sPRQ{R?STm8V}W nX iY sZ c[ r\ a]R^{_?`am8c}d ne if sgRh{i?jk}m fn no ip,q mr is ltRu{v?wx}z p{ u| s},~ m i lR{?} m i lR{?m8} n lR{?m8} g lR{?m8} g o lR{? = .Sh?}}{^x}5{?{4 # #}}}$.7$}$,${  t p 2 {5{{6 #}}{QI{4}$$$ / u m 1 ${5 # #}AI{4  } }  =$#${q! 5 . -j j5!r"{#$!% 5& .'() #* #+}- ./I0{14235565758995:5;E<=g?}@$A}BC{DEF$G{HI5J/KL #M #NgP}QR{ST5U/VW #XiZ6[\i]^$_}`gaIb{cide4"f 3gh (jpklno6p5qSrsStu6v5w9xy9z5{E|}E~ /g}$}{${5/ # #g}{5/ #i6qi$}I{i4"  xx1 .d3d =8 =3d =  = 85 u m 0 1 - 7.) 6 .  u m 5 59 -)2 5E)}$$ # #I}${5}}/{{ $ { 7  / #}}{{}}{ v{ }!}"#{$S%&{'}(})*{+,-{.Ή/0 #1 #2 4 05 76 37 08 79 2: ";4<=}?{@AB ]D [EFG )I (JKLN5OIPQ}S}T$U0V .W IX}Y{Z![ 5\ .] 7^ 1_ o` tabc5d$e{fg{hi #j}l}m$n0o .p Iq}r{s!t 5u .v 4w 1x oy tz{|5}$~{{ #}}$0 . I}{! 5 . 1 1 o t5${{ #}}$0 . I}{! 5 . 8 o t5${{ #4j14j14j14j1  4 0 3 2 6 2 4 "  5 0 3 3 6 2 5 "  6 0 3 4 6 2 4 "  7 0 3 5 6 2 5 "  8 0 3 6 6 2 4 "  " 9# 0$ 3% 7& 6' 2( 5) "*+, . A/ 00 31 82 63 24 45 "678 : B; 0< 3= 9> 6? 2@ 5A "BCD F FG 0H 3I EJ 6K 2L "MNO Q 7R 7S 3T DU 6V 2W 3X "YZ[ ] F^ 7_ 3` Ba 2b 2c 3d "efg i Ej 7k 3l Am 2n 2o 3p "qrs u Fv 3w 3x Cy 6z 2{ 3| "}~  9 7 3 3 2 2 3 "  8 7 3 2 2 2 3 "  C 0 3 A 6 2 "  D 0 3 B 6 2 "  E 3 3 C 7 7 "  D 3 3 B 6 2 "  C 3 3 A 6 2 "  B 3 3 9 2 6 5 "  A 3 3 8 2 6 4 "  1 4 3 B 7 3 5 "  0 4 3 A 7 3 4 "}{}5w - }5w   }  { 5w - {5w 5w u m5w{ ! #" ## #$x&}'}(})}*!+ 3,-{.5/01 2}3o4!5 367{859:$;<}=>{?@A$BC#D{EqFG{HI{J?KL #MxO}P}Q}RS$TU}VW{XYZ$[ \}]o^!_ 3`a{b5cd{e f}g!h 3ij{k5lm#n{oqpq{rs{t?uv #w}y}z{$|}}~{$ }o! -{5y#{q{ #}}$}{$ }o! -{5. #{q{ #  2 6 3 0 "ͮ  5 6 3 0 "ͮ  F 5 0 7 "ͮ  E 7 1 0 "ͮ  E 5 0 7 "ͮ  4 1 0 7 "ͮ  5 1 0 7 "ͮ  6 1 0 7 "ͮ  E 7 0 7 "ͮ  F 7 0 7 " ͮ  2 1 0 7 "ͮ  3 1 0 7 "ͮ !}# u$ m% 1& '}( .){*+!, - u. m/ 20 1}2 .3{45!6 47 8 9 u: m; 2< =}>}? .@{AB!C 7DE{FG!H 7I J uK mL 1M N{OuPQ}S}T .U{VW}X .Y{Z[}\ .]{^_!` 6ab5crd!e 4fV~g{hij}l em en eo{puqr}tuvw{xuyz;||};~5_>5_>}~5_>5_>5_5_ =5_ |4845_ry4 f5_>5_  =4} - k{4} u m 3 - {4~ = m8m8}}} u m 5 . 2  t p 4 3 . t h g i e h "3 u m 5 . 2  }o{5} u m 4 1 { 4    $ # v${q{{} 0 7 2 1 "i{ !}# h$ u% m& 9' -( ) 6* 2+ ',i-{./ =1 23567 #8 #9;< #=?6@6ABCD$EFGHiI^JK$LMNOiP 'QRSUiVWW tXY[W\^]^}`{a}b{c}d 2ef 2gohij{k5lm9o -p Wqr ;t Wuvx Wyz9| W}~ y$25 h t p e d5E t h g i e h3225 h t p e d5E t h g i e h32}$2${5/$$25 h t p e d5E t h g i e h3225 h t p e d5E t h g i e h32}$2${5/$$ - k u m 7 - }$ u m 2 -  - k u m 2 - ${e< u m 7 -   > 4 $$4 u m 7 - }$ u m 2 -  ! -" k# u$ m% 2& -' ($){*+e<, u- m. 7/ -0 1 -2 k34$568}9$: u; m< 5= .> 1? @ .A uB mC 5D .E 1F GH$I{JKe<LMO "P3QR}TUiV FW 7X "YMZ 1[o\]}^=_`{aibc{de #f}hi j Fk 7l "mMn{op #q}st u Ev 7w "xMy{z{ #|}~  D 7 "M{ #}  5 9M{ #}  4 9M{ #}  2 2M{ #}  1 2M{ #}  0 2M{ #}  9 1M{ #}  8 1M{ # X m e 5 2 1 . -} E{ x e 5 . m e 7 6 6 1 . - T6$,$$4" 3}}} c{ x e 7 0 . { 5 {  }6}Ϲ 4 2Ϲ5{5$  4 2M x! e" 1# =$5%E& '}(){*+5,/-{./ #0}2}3Ϲ4}526}7 28 29:{;<{= x> e? 2@ .A oB tCD}E xF eG 3H -I{J KϹLMN 3O{P!Q{RS #T}V}WϹX .Y}Z x[ e\ 1] -^{_ `Ϲabc 3d{e!f{gh #i)k=l 1mnoypqrs)tu #vxy tz p{ #|1~j5 -r15r}}#{q x e 5 2 .jV~{˳ # D 0 2P B 7 2P 8 7 2P A 7 2P 9 7 2P}$ "i${˳ # # # A}} 7 2 '{) 7 6 . { x e 1 -)2  0E)} !{ 0/˳} m e 3 . h t d i w "{  m e 6 0 .˳7 } L 2 3{ 0S o t} L{ 0/˳ l 2! 3"#$ a& 3' 2(M)* 3, m- e. 2/ s0 u1 l2 p354h5]67 39 m: e; 5< .=9> ? m@ eA 3B 3C 3D 3E .FG H mI eJ 2K sL uM lN pO5PhQR6T4U 5V 5W5X;YZ <[jg\ ]}^_`a{b}c4`d .ef+g{hlihjkl #m n .o #plrs5t}uv+w{xiy}z{{|5`}5~ 2  3 . - s u l p5   0 5 2 -5  3 . s u l p5  #h2 i2   2& }4`{C #&56}kB{k/6}5{BS o t5/$}{5S o tB/B#}4B/5{5/$ W5/#o&WqSdW 5 / } } k5{\/g645 *8{ !"#k$/%&\'.(5)/*+,-/02 1e2 -3)42 5}6\78}9{:e; o< t=>{?@\A/BCeDE)FeGHJ+-K5L >MN OkP Q)RSTU4 V #WjYZ\6X]^`ka 3bcdeg 3hiij6{uiw{k2 mWql+}|$r(ov}nyx~sizp/\\/3d = /85 = = 6m2 s8  = 3dGQ}{4 36msB >k #6m  6r7r$.4" 3$}5{g559}{5/$ #5T}{5 o t #}{5 o t #}{F #}  { F  #}{F #  o t62 0 0! 2" -#5$;%[& <'jg( )*+6-4. 0/ 00 11 -253;45 <6jg7 89:6<= 0> 5? -@5A;BMC <DjgE FGH6JjgK -L M$N5O =PjgQ RSU -V5WXY r[\] _ 0` 0a 5b -c5def7h 0i 0j 2k -l5mnop5r5stv5wxz -{5|}[y5 / 5 M M 55 h t d i w M˳ = M() M 55 t h g i e h ") = Me( 8g - oj5r5j! 0 0 0 1 -V~! 0 0 0 1 -[  M  3 m e 2  3 m e 1  3 m e 5 .   m e 5 .  m e 7 6 6 6 1 . -   m e 7 6 6 6 1 .i6 3i$5ri !"5r$}%&{'()*+ #,. / `02"124 567 8 `92":;}={>?@B DE ]GH [JK 'MN `PQ ST VWYrZ[V~\X]j^_ a 0b 5c 2d 1e,f `gh 0i 0j 5k 1l;m `no 0p 0q 0r 2s:t `uv 0w 0x 0y 3z!{ `|} 0~ 0 0 3? ` 0 0 0 3. ` `, `; `:!.? K  `  ` } ` s X g r # h w ;O{{ f o g5 8 8} d l o} e 2 0 0B t 4 2 t-Q 2Q b6 2 7 3 7 i ; #B 1 n 1z 4 8 1Q 0Q 0 4 4Q   h # 5 f i  9 0 1 !"#$ #% #&(^)}* e+ s, l- a. f/{0192}33d4 =567{> f9{@}B}GM aJ={C t?F rA{; eE uK8}P9NO =Q sL lI<8:H eDR9STUVY^WX^Z[^\ #6_}`a b wc ed ne f ag h ri oj fk l mm on oo rp q or Ns{tu$vw <xy 1z { |} #~ # #}H ={H =2!i =Hi 4 i 2  ui 1  i 0  y bi2  #}H ={H = 1  =H B y b 1 2  # # # # #N2!h 962! 862!  762!K 6N7 5}{66 # #i2! 4 N  w 3i6 2ifa u 1i i!! " 0#$%' (Ӻ)*~,8-%.8/081_283 485^687#889&:8;$<8=}>8?{@8A\B8C D8EFJH? Xy+ I :W::4:!F::j(_:  v:=:(:s: :T`:O7rukh;Pe3gY?2 GPHDJN.NE;(A;,M>ZT0(;Ey;fyBEL;ӻ;;ӿ; ; < = >  ? @% A" B C;?;yvyPOA2x;)o;QGjH<%{0hO"v2! ? BI|2h0 &Kcz\Y?vJN $K9_< xmՓpՠ 'K={ո < =  > ? B!C{l{tE|aL!<7amL'q.|rv <  = >  ?  @  A  B  C  D  E  F  G H  I J  K  L  M  N  O  P  Q  R  S | T  U  V  W  X  Y  Z  [  \  ]  ^  _ ` a b c  d  e  f  g  h  i  j  k  l  m  n  o  p  q  r  s ~M t  u  v  w  x  y  z  {  |  }  ~                   ~  }  |  {  z  y  x  w  v  u  t  s  r  q  p  o  n m  l k j  i  h  g  f  e  d  c  b  a  `  _  ^  ]  \  [  Z  Y  gX  W  V  U  T  S  R  Q  P  O ?MN  M L  K ~()/h i #47L[n]j <n*S<\0N$#r"@Kvخ<X@Xb;A2AZ%5<L%GTgB$CtON'>GL`oL'u(~(BUL/NQo ,<W')]L, *+M*90}~*tt\dY*[L+.It+~2$G[eV,1*GI|i{i&dL. 7 9w :w ;p F.81)G.e6.qLKbL _/\L: !LL/tL~0r&<0pG0R1?I1TMMT<dS=R> Q?2P@21"zGOANBMC2LDdKEJFIG'FJ'EKDL'CMBNAO@P?Q >R=S<T;U:V9W8X6Z1_0`/a.b,d+e)g(h'i\&j-%k$l #m"n!o prstuvwyz{|}~ 1 !  dd2 ^2" G> ? @A2!XB2"cC2# <XDEFGHIJKLMNOPQRSTUVpWoXkYfZe[b\Y]L^K_H`@a?b7c5d1e"fghijklmnopqrstuvwxyz{|}~U2c~XF*$2lJGRS:6~}|{zyxw6vutsrq9ponmlkjihg.fe3d6cba `_ ^ ]\2"G[Z2Y RXWV UT S RQPOlNMLKJIHGFEDCBA@?82zG72M,2{G'2|G2}G{|}\T3>z]3e{3j w3{k3W3T3<@3753d3{33{4 w4#{4:N 4I~4a~4tv4|Md4y]aLL_]4?J4H42?4{=4~<4}]44 *K"442%G424B 4F 424 )K5`5a:5s#r5l`5/W5*U5D5@5">5@G-} *5N5y5 5XL55 F662&GB676VpL6Y6`&6d7o;6nLV6;D68?-S@&6Z#SJ6c6FSk6c6Z6;67Z772-G7 7#BL74i7HM*7o`7 F\7|]YTK5C7"7F7c7M788cLT8_2.G8hNTuc8<8G$8!/G 9VrVe$WIt8Lj;TX_z 8fLXm-~X{; y; x; w; v; u; t; s; r; q; p; o; k; X; W; V; U; T; S; =<rYV / 0 1 2 3 4 5 6 7 8 C` D^pYe; d; [ZXZxV=JL=߂>pNKut[޿_ ޼~޷lT? vP+\ kU[<Z=#Y> X? W@^VA:UB2TCSDRE QFPG"OHNIMJ1LK@KLJMIN\HO[GP8FQ9ER DS$CT BU!AV@W?X>Y=Z<[_;\:]!4c3d(2e)1f0g+/h;.i-j:,k=+l0*m1)n2(o3'p4&q5%r6$s7#t8"u9!v: w;x<y=z>{?}A~BCDEFGHIJKLM N O P Q RSTUVWXYZ[n]abcdefghijklmnopqrstuvwxyzfjgslILk% 2)G^zFۿ[ۻ_۵e۟{ەۃypib_]_\S[XWT3O2NM6KJE0CB<A.?>==<:L9"8532 10-#,+C)~'&i$"ڽ_ګ8ڢxڛڗywRnJA9P6  N $'23/HQRTlVXYٽ]ټ^ٻ_ٷcٴfٳgٮl2٭m٬na٫o٪p٨r٥u٤v٣w٠zqٜ~ٛ:ٚٙ٘#ٗ/ُِٔٓ-َ]ٍى7و لق}{xwFvEsfld_^\Q<1X4ةqbb |PpFzBv/\  ^EKL'b.H ױiל~rיוהד׏׎onm^RQON3 vFr JM 4 A PW֩ q֢ x֚ ֙ ֖ ֕ ֔ ֓ ֒ ֎ D֊ ֈ ֆ ր j | { uv u 1l 5k j d V` _ !^ \ [ BU SN K G ^F D 3@ V= Q< _8 5 3 w2 -_+TL( ' f#  A 3 /    4      8  x   " $ %N & ( -3HT 4 6 ;> = E L Rմ fUՀ }HuM<HL0 .}G"5   H3e fԵ~Ԉ uPpJ 1 Ӿ \ӰJBMz MB &`{m(JUw>ksa:G1_G1^G2?G2G2G2G2G2G2kG"G"G" G"G"_GPGRG]Gҿ\GҾ[Gҽ:GҼ9Gһ>GҺ<Gҹ{GҸpGҷGҶGҵGҴGҳGҲGұGҰGүGҮ_ҭ{ҬҫҪҩAҨLҧҦFҥҤwңLҢ+NҡҠpҟ {4ҞҝҜқҚҙ{Ҙ~җNҕҔ>ғ"1Ғ|ґMҐM  ҏ Ҏ ҍ Ҍ Zҋ ZҊZ҉Z҈Z҇Z҆Z҅Z҄Z҃ Z҂ Zҁ ZҀ Z 0 Z~Z}Z|Z{ZzZyZx Zw!Zv"Zu#Zt$Zs%Zr&Zq'Zp(Zo)Zn*Zm+Zl, Zk-!Zj."Zi/#Zh0$Zg1%Zf2&Ze3'Zd4(Zc5)Zb6*Za7+Z`8,Z_9-Z^:.Z];/Z\<0Z[=1ZZ: >2ZY: S: H F: D: h)P C B > 6 ': &: %: ! hO   : & ! "? &w (w +w , - .9wTњhYјhgZi8i53%iVisi}i9isMЊcЁ?|& uikUMnG DCA@j->9h6/)($#!cK G  g'(-m0<d@ABHjK3OCQR`Ͽ[ϼ^vϹa϶d HϳgϭmiϬnJϩq)ϦtϤjIϜjϐώIϋω}T|4zxtUmkQgfd}a PEk(?k.:8 R7k6~6320%,O+''%#(  VG  l   ;  Žkj~6"*9k~/@6 bhk<?αΰjΥu Τ.ΠΜ~9ΗzkΑY΍ΌZ΁!e[HOA] >O# ;c9e6h4j (v'w$lIO#{ !} ~O      lg͵lͱs͂>tP~4XmPmRMCm*:m3)mD !mL)(mYm^~mjmy"mA̷m̰QBUm̥ṃQO̡m̝m|momfnenYn!$nhpnnw˩q}˥ny˖nxZfAo,>o/*9 { 2o;b'&ɚoQ.voehoʨSJDLʘoʖoʍSesof ?SZLp\lppɱpɞpɀalTWqQqO)TTYLqHLKȮșq4UYȃ=wInqhr] >r/8r552U^L-r@"rK{rT9rgrqrurǿr=ǹrXNjVgMvV|ssVNYsUH+rLsSZsT #alLsAƝ}!}C|rs;f;1:t3*XrnDSŏ1ŇALvJEd\``Msi9χ :1+G?2(GX2NOIJu:Ĝ$Ćhrtb]vGv&Y6s8Jm9 h9 i9 j9 k9 l9 m9 n9 o9 p9 q9 r9 sý9 vü9 w^û9 xù9 z÷ ó9 ò9 ñ9 ð9 è9 å9 ß9 Þ9 Ý}9 Ü9 ÚA9 Ø9 ×9 Õ9 ÔÒ9 Ñ9 Ð9 Ï1ÎÍ9 Ì9 Ë9 É9 ÆÀ9 ~9 }9 |9 {E 9 z9 y9 x9 w9 v9 u9 t9 s9 r9 q9 onZO MJ2,+*#"\ ZN$)OL6AFI'GN,V ¿[¼^»_ºF´f°Gªp©q¨r¤v£w  ž=G}” pG“X Œ9 ‹~9 Š9 „pGƒ=~k}"M|7z%+x[z@Lw(v)Fts,o0Qj52Gi6Mh7|f9we[:V`?2G^A]B22G\C[ZEFYFVXG23GWHUJ <9TKRSL"GRPO"GNQGMR|LSKTVHWOGX^FY2!GD[FB]FLA^?`}G=b"oG6iNҊ/E$  7& I',>.{167=%>\MDRY4N Gir0xx;CkvusrpP[mUhe:'\CFTKQNwI.F@,|+t)${72!GӣD3sp G jLӽ'66x"\GeGvhLGQLN`GVv?GMLb9"[G {:G2jG2Gbj MF{ "_G G 26G 2Gl Gyw m|wz%Gy&gw(tzl3khXFL=H8<Ԅ\3 FRD}^uNkb^a %K]Bx8m7n(}A'~B&C%D$E{#F"G!H IJ <YKLMNOPQRSTUVWXYZwABCDEFGH^IJKLMNOPQRSTUVWXYZ.c}k"4G{Mh5sy&m2j5I\dMs@ր7h2'E֪aJL "G e G{e"G0"Gc |{w4 |{$3z%|y&"^Gw(4v)2 Gp/oQkUi6!1f90b=a>[_@[DXGWHSLdPOGNQMRHE}(C\" GB] F>aa}/9f5jw4׌3l-2׎1nY+t?(w2G'xE${ZePL%ר\QG=Lׯ SL2G!?G23GJUM+"]M p.##a_KT5= 6؊'x"G&ؚ$؜ز a~x- )6rNkse:OL)A$8gOoNL%C <9e] BoE(`$ڜ M[ F oc < O_d, @^ A] BY FQ NxRP&< cpG9d6 ipG( w5۩ Nh 'de=e ^e?VL p G|Due}VGgY!d\SeLGN QpG@ _pG2eFGeM e CK e^ C4G eUGVs {Lfbc Fp /4h 7b ="qG_ @^ A\ C1[f$ Y FT K"Q N@GO(J U;D [C \2aG> aC=(< c G9 fbG8 gH6 i G/ p^, s~) v\& yR { {    { `:G { rG   wgv Z  G {   7 \tu {  2G C |Gg3qg;v M 2G 0 1G 1,G  F  c M  !G ] z| #$k 4`gZg>U J"1S LZRgzQ N!NN QGM RRLK T2`GG XF YFB ]"^G@ _G> aF; dZ8 g1-G7 h%Z6 i2'G5 j 3 li, sZ+ t"Z* u0G' x"uG% z$ {$G! ~Z  "G'Mg; Z 9K   g>  "tGg|G a Fyv M "]G  h@ ; M #{sF*?h;!hnLEc{i"cwwwwwwwèv w U w w wXwwwww+wwwwwwwwwww !@"s#r$#F%$F&%F'&F~(})w|*w{+nz,[y-x./w/v0,si*l+k;wij<wi=wh7h>g?{f@w^iT]IYMVPFUQiRTJ\wI]}H^wG_F`EaDiCcUB+d1Aej<iLjF;kF9m%6pF1ug0v/i<Xw*iN|!)}(~-'}&wi;GwSi~X     +i~,-./012?Lj Ij' DKj22ćqj6Mj:Mj[jhIjqrjr (Ktj~ #K"}, j_jN  YvNk2-akA]uCL\kY-k2,GMkK-dB]WA^P7kW#kF. k&J3./l?WLlAgldB1NV.r,l++T/Al_iLmm&ym93kǾIrmlm/ }a. ~b- c, d+ e* f) g( h' i& j% k$ l# m" n! o p q r s t u v w x y z a b c d e f g h i j k l m n o p q r s tmsG u v w x y zZ02Oen>Q~G3??33ȧpi=4acȳh?niHLno"nGx'2vGYnkLSn <YPOGHnS=nq4nZ!n&G"5Gn_n#G6gLT o2oo?B(z1to~c<BL1N5of4o <Y*u21,o4GpG2R2wGʭSpe2GVIVUp >>L3)˛NG˴ 3{Go3hTxI,N4Lr%2G̎4w}"xrz!.Gbr FQN-E43l{04/p.eL"yGf58TGsuz} FVSG͛MVV5{Vͯ.WG>:w5u*Mo5j5{h7@e:Nc5nb5a5MR GX{EZ>aM=b{9fb6i{-r&y!56 ` {G6,  <X6.<}Z}-NnTa6P6Q}L9`G"G6\!Ί66aZ6mZΧ+ 8G {C{$ {v)~Lm2f9{_@2SQ~GNJUF6?`y;d)v{]&y36+N7&% 7E-7'I Q71874D<X7H<X~T7SXπ% |u3rφ7i7suN`Lϥ vHG<t" G7Z!ϺHw7qo0fd; Za>bL7[D" GJ7GXD['G;78 6i%G'x\#76'8 2G88$z8+22/G 8>;8@2G8I8K8L8TF8fT "KvJM8u&8v8z8{8| 8~:c<2GW7h$8Q#8E+89 299(\_L91939Dr9H9J27G9^y9iB9r999g}Yl9e9'M9.9+9a$9_ 9:]T3:2}n:D x+1(G:b  : #&),/258;>ADGJMPSVY\_behknqtwz}  "%(+.147:=@CFILORUX[^adgjmpsvy|  #&),/258;>ADGJMPSVY\_behknqtwz}  "%(8;>ADGJMPSVY\_behknqtwz}            " % ( + . 1 4 7 : = @ C F I L O R U X [ ^ a d g j m p s v y |                                                       " % & ( ) + . 1 4 7 : = @ C F I L O P R S U V X Y [ \ ^ _ a b d e g h j k m n p q s t v w y z | }                                                               ! $ ' * + - . 0 1 3 4 6 7 9 : < = ? @ B C E F H I K M O Q T W \ a f kx pl u` zT H < 0 $               | p d X L @ 4 (         $ ) . 3 8 = Bt Gh L\ QP VD [8 `, e  j o t y ~         x l ` T H < 0 $    t \ D ,        l T #< ($ -  2 7 < A F K| Pd UL Z4 _ d i n s x } t \ D ,   p X @ (                   #&),/258;>ADGJMPSVY\_behknqtwz}  "%(+.147:=@CFILORUX[^adknqtwz}  "%(+.147:=@CFILORUX[^adgjmpsvy|  #&),/258;>ADGJMPSVY\_behknqtwz}  "%(+.147:=@CFILORUX[^adgjmpsvx`H0pX@(P  hP8 $).3p8@=BGLQPV [|`Lejoty`~0l< |Lh\,(hdH $d#(D-278<AFK4PxUZt_dins8x}xl`TH<0$  |pd X%L*@/44(9>CHMRW\afkpuzth\PD8, xl`TH<0 $ $).38h=PB8G LQV[`ejxo`tHy0~pX@(hP8 | dL4#(-27<tA\FDK,PUZ_dinslxT}<$  #&),/258;>ADGJMPSVY\_behknqtwz}  239Q-,,,,,,,,,,,,,,,,,,,,,+XK`y Q-,GQP                      "               L   5  $   W  * R   5   L  .  $# $ * /      H B@   V :    :: BB JK ! :UUrq#GG:Wr@:W8\rUW  *  # G83N8GU&HqTQ3|r8U#?GlLi f l '?!)]il'?!)]`\'"?!-{-|`<`>aeaocAoea.,oeuraAOCGQyeoraAuXWAVYtubyvwhkeoxdcqvj ywtCOGUQTYVWjI88rq*G8UUrN8 rWo Q-,FPO                      "              L   5  $   W  * R   5   L  .  $# $ * /      H B@   V :    :: BB JK    ! ӍTV7 pS^7#eS *K]l$61h1BRYzK ? ` gY"UT$&e@foT@ ;2AqlLi f l '?!)]il'?!)]`\'"?!-{-|`<`>aeaocAoea.,oeuraAOCGQyeoraAuXWAVYtubyvwhkeoxdcqvj ywtCOGUQTYVWjIn: q|r9:AT ?W|{YQ-,FPO                    !               L   5  $   W  * R   5   L  .  $" $ * /      H B@   V :    : : B B J K      \tXN<PZS @],|vZ1NfJ#@]}.Vx \hȐ0Xq8X']vww9cqX\r8996gaeaocAoea.,oeuraAOCGQyeoraAuXWAVYtubyvwhkeoxdcqvj ywtCOGUQTYVWjIIÎJ8aeaocAoea.,oeuraAOCGQyeoraAuXWAVYtubyvwhkeoxdcqvj ywtCOGUQTYVWjIplprZ#7n9JrrYAaQ-,HRQ                       "                L   5  $   W  * R!   5   L  .  $# $ * /      H B@   V :    : : B B J K    $ pN7GGxo68jqtQ:#8L`~xncUPws\>RwUPVT*xVT 5*dDVJUTVTU**,1|qlLi f l '?!)]il'?!)]`\'"?!-{-|`<`>aeaocAoea.,oeuraAOCGQyeoraAuXWAVYtubyvwhkeoxdcqvj ywtCOGUQTYVWjI|qq9j81c*TUPEZQ-,5>=                                  =   &     H   C   &   =             9 31   G +     + + 3 3 ; <       0\txW;;:g uY' Sq>wʯ"Z#*|x]?rf',M$r8UWfx{f>9G|r,W@9(,rplL`\'"?!-{-|``aeaocAoea.,oeuraAOCGQyeoraAuXWAVYtubyvwhkeoxdcqvjywtCOGUQTYVWjIoӍzN8,rX\t '? b> Q-,&F< \ 'Q I 'M [ T 2  E : R @+  $         04 9  !,#-/)7 > C !=6 Y#Daaaa!!!!!!!!! !! !S!4S!( N "O J X  L B U [  !* +] F ` W Q A V P ; 5 H 3 1_ 1Z 1 1G    aa !'  % #  (0  /&  ^8 "  /K.   ?!!  9}qr9*JS_`eVqv W+-d4r4I0OgE~9UUWVJ!'9{A]Vekn9:ӏ%(alsVsGwHHPUW~9Ƿ q 83N81d&qbT$31d z2`DGP[`puq8p9!c8;:;:==;:=;:=;:==;:=;:=;:Y Zjf  ;: =;: ;:; : =AMNY ZqG:*Wtc8UU@N8 5" *Q-, %F9 [ 'P H 'L Y R 3  D ; Q A+  $        03 7  !.#-/)6 = B !<5 Z#C````!!!!!!!!! !! !S!4S!' M "O I W  K @ T Y  !* +\ G _ V P ? U N : 4 E 2 1^ 1X 1 1F    `` !(  % #  (0  /&  ]8 "  /J,   >!!  ª*JF8W^8^% 6dM" ,qKGLMTOTqi$zN}T~76e{6|>8JKGRTp^cdeSej|Bjp6;o& M*JKK]lDΑo  1j1>-Kd*RR&6 ?8Y/Bq$A&e@puq@>&9>ACRVbcrx,2q[9ێHbf8;:;:==;:=;:=;:==;:=;:=;:YZjf  ;: =;: ;:; : =AMNYZ9|rA:UHuV@ ?2,Q-, %E8 [ 'P H 'L X R 4  D ; Q A+  %    !   /4 7 !.#-/)5 < C !=6 Z#B````          S 4S ' M "O I W  K > T X  !* +\ G _ V P @ U N : 2 E 3 1^ 1Y 1 1F    `` !(  $ #  (/  /&  ]9 "  0J,   ?!  \t}au3N<opxy{vŴ˃<p) X#-3@CG]ZS_`m zSvۄ-8Z z $(P+e<G Iac8cu> ‚:Dw]fiDslx"2\+ )rq'H'Iww9Nr'H9 K67r}rvxq["r.:;X;:;:==;:=;:=;:==;:=;:=;:YZjf  ;: =;: ;:; : =AMNYZÎ7 [#Caaaa          U 4U ' N "P J X  L ? T Y  !) +] H ` W Q @ V O : 2 F 1 1_ 1Z 0 1G    aa !(  $ #  (/  /&  ^; "  3K,   A!  `haLVVpln;J#c(b9:85~ Ra\2BJcrr|tWXW6 )4F9@L;US:1W09EAuN9ȉq@0E8\q , `+B087=@L@I{W=\ab}gn9t8wi}J,<;:;:==;:=;:=;:==;:=;:=;:Y Zjf  ;: =;: ;:; : =AMNY Z7#n9ZVtn9UJ@11Q-, #C}4 Z 'N F 'J V P 1  B = O ?*  #    "   ,1 5 !. +/(3 8 A !;6 X @^^^^  R4R$ L "M G U  I : Q V  !' +Y E ] T N < S K 7 0 D / 1\ 1W - 1C   ^^ !&  ! #  (,  /%  [9 !  2H)   >!  GhrqpS8r#I>I?Zeln8z~ &pTՄ&s #/0-LZ[\B`cjlqstN7e ӻޒQ'M\[f qd^0̀́[G !'u*+UR%UVTʫ0%*RY%UVʫ0%V*)U*:15(77!  Jfs}stV":*?DEWKjUWY[E_bbhukq}ktW; bWEWXk#F#')Y)35X:?FHRV<`tglnr=w !!0 Y &Z.>/Y<MQS`iBjYwZÔ#e\k?rf'S,M8UjxI{fӍ|r,@U"r)T,r-/g;@ACK}WXZ_]U]_b9yq#:c3;:;:==;:=;:=;:==;:=;:=;:YZjf  ;: =;: ;:; : =AMNYZӍ,rN8XzV:S @'\x-!", 7Q-0,           *       **  **  ** * **  ** *  *( (      "       &     + $ !  # '     )            % %        *qqCGqrJ::r B!n" /8?L *4tUWqy  Mfe3N8q1d:U\T3q1d8UK\ $GMW_}9rvy=0000000G:Wtc@N8 o r!xpf +  Q-,          )       ))))  )) ) ))  )) )  )' '        !       %     * #   " &     (                         $ $              ڪp#G*=*D_sp6 $1Xc)Rl8 (D ? aHY q/BqqUTގ&e@quqT*^@ wABf0S Q^UL}N0000000AUHq@ ? e RUX*e @,K  Q-,          )         ) )   ))  )) ) ))  )) ) )  ' '        !       %     * #   " &     (        $ $            N9\tN<u @|vM @%1?Ms{M #]uxˮ\;AO@o \)q' [qHXYQww9' [qHX {YQ89l 7?Fmjkgr'|xBZÔ x?֛Gf'SwC,UWjx{fӍ1CG|r,W@RS,r1BCW1c_i=mmŃ`0000000,rXV: 7@'\xOJ Nxx e@ u  Q-,hijklm n oDE . /       ! " #  $  %  &  ' ( ) * + , - 0 1  2  3  4  5  6  7 8 9                         GI KMOXYZ[\]^_ acdfg        q r s t UU*WG:Wrc\t;sUW q  q ; t qufe318   y  8q 0@B1AC246357465726378<:>9=;>8:>9;>?w>xy?8;>9:>BCvtu~wx?y?~wwN8 fer]m#R  JQ-,NVU . +  & ' + ' + '     - -      !  '+/ 2 +  . .*     +            +   ! B!  ( 4  # &  M % ) H0 & ) 4 )   " -$ ! #1 #! )! .       ? 9   L     ,9 9   @A#  3   c:1UUjrUXqs::*\rj:WrtcuW:WX88\rW#UWt q U3qjUQ9,n83|r8U@#?GlLi f l '?!)]il'?!)]`\'"?!-{-|`<`>eaocAoea.,oeuraAOCGQyeoraAuXWAVYeoxdcqrywtCOGUQTYVWjIqjr*GUUrq rZKtEo LQ-,KSR 0 ,  $ ! ) , ) , )     . .      ),1 3 ,   0 0*    , , $  B#  ' 4  #$ !  M & ) H/ ! + 4 + "  ( -  #2 # ) .     ? 9  L     -99   @A% 4   8:V:UVUWrVN:qqsG:Ws8Gcqx;t*8;*UW 8 t p*q5V?G[px9:r8G9pr#@GlLi f l '?!)]il'?!)]`\'"?!-{-|`<`>eaocAoea.,oeuraAOCGQyeoraAuXWAVYeoxdcqrywtCOGUQTYVWjIpr*GUVr* rU  NQ-,3 1/ ,  /& ' ., #' , #'  6  ) '. ). '    &  '!*  &',0 .3 .,  / +/ +    0  ,, 0 + + + + + + + + + + ,  - ! B!  .( 4 . 1# .&  1M % .) H1 & ) 4 )   &" 1-$ ! 4#2 4#! 1)! 5. . 3 2    ? 9 ' 6 *L  ( $  '-9 9 *  @ A*#*% *  4 & " c:1UUjrUXqs::*\rj:WrtcuW:WX88\r` W#UWt q U3qjUQ9,n83|r8U@(-1@@NANHPcju|8sJf,̈3Jdܔ7/e-p.L2HPVQkn+lLi f l '?!)]il'?!)]`\'"?!-{-|`<`>eaocAoea.,oeuraAOCGQyeoraAuXWAVYeoxdcqrywtCOGUQTYVWjIqjr*G6jUUrq r PQ-,-{ -1 -  $ +! * )- * - *  3  # / #/    !'  *- 2 )4 )-   1 &1+   , (- ,&&&&&&&&&&- *$  B#  )( 4 ) -#$ )!  -M & )) H0 ! , 4 , "  ) --  1#3 1# -) 2. )0 /   ? 9$  3L  #   $ .9 9 . " @A.%.'. '%5%   8:V:UVUWrVN:qqsG:Ws8Gcqx;֍t*8;*UW 8 t p*q5V?G[px9:r8G9pr)*@*D1114HJ@MQT_+nLsuiS6H<۝k6H LMRilLi f l '?!)]il'?!)]`\'"?!-{-|`<`>eaocAoea.,oeuraAOCGQyeoraAuXWAVYeoxdcqrywtCOGUQTYVWjIpr*G6jUVr* r`"V   SQ-,OYX ' #   $  #  #      ' '     # ( + #   '  '#    #  #  # L  ! 5  $& $  W % * R) $  5   L  ." $, $ * /       H B @   V :    ':: BB JK  * 1T\px<qpETn7cSqj QUTYeqrX>|r8UT(IQlLi f l '?!)]il'?!)]`\'"?!-{-|`<`>aeaocAoea.,oeuraAOCGQyeoraAuXWAVYtubyvwhkeoxdcqvj ywtCOGUQTYVWjI:8G\r9 QTGq G`t :   Q-,OYX ( $   %  $  $      ( (   !  $ ) , $   (  ($   $   $  $ ! L  " 5  $' %  W & * R* % 5   L  .# ! $- $! *! /      H B @   V :    (:: BBJK  + S=AB$@3gds-PS/F&6bef!Ehqf  9(-~HQT^ & ^ u j3c,@3oL@%D(KlLi f l '?!)]il'?!)]`\'"?!-{-|`<`>aeaocAoea.,oeuraAOCGQyeoraAuXWAVYtubyvwhkeoxdcqvj ywtCOGUQTYVWjI 3.hCKve. ^.a2@  Q-,PZY ( $   %  $  $      ( (   !  $ ) , $   (  ($    $   $  $ ! L  " 5  $' %  W & * R* % 5   L  .# ! $- $! *! /       H B @   V :    (:: BBJK  + DFϧݗ [}*Ñi Q,,q{+&jlXR\v`%Nj*v E 8 G:9UV9R'DF}(9:cqDF\r89">E}lLi f l '?!)]il'?!)]`\'"?!-{-|`<`>aeaocAoea.,oeuraAOCGQyeoraAuXWAVYtubyvwhkeoxdcqvj ywtCOGUQTYVWjIǴ}tO.>EaDF#9 bf$  Q-,Q[Z ) &   %  &  &      * *    !  &+ . &   ) )&  &           &  & ! L  $ 5  $( %  W ' * R, % " 5 "  L  .# ! $/ $! *! /      H B @  V :    )::BB JK -   LO [>%H,gwTTie>&fGGf -fTD #l  "" B#Iqʪ>lqq̓q$@`IWc80;\q9H?lLi f l '?!)]il'?!)]`\'"?!-{-|`<`>aeaocAoea.,oeuraAOCGQyeoraAuXWAVYtubyvwhkeoxdcqvj ywtCOGUQTYVWjIuV ([Ak?I }q dEt  Q-,S]\ * (   & ( (     + +    "  (, . (   * *(    (            (  ( " L % 5  $) &  W ' * R- & # 5 # ! L  .$ " $0 $" *" /        H B @  V :    *::BB JK  /   \q_ Ϥ BN[m'  o)=?JBDCbbo|2,feu,1GJcei<voSj$QRyl"@ʫ=*32h"JUTVU**3239lLi f l '?!)]il'?!)]`\'"?!-{-|`<`>aeaocAoea.,oeuraAOCGQyeoraAuXWAVYtubyvwhkeoxdcqvj ywtCOGUQTYVWjILeeS39s3ϤYeRyea-h  Q-,PZY ) '   %  '  '      * *    !  '+ - '   ) )'  '           '  ' ! L  $ 5  $( %  W & * R, % " 5 "  L  .# ! $. $! *! /      H B @  V :    )::BB JK .   .51_aRnncv5ʥ41\l|kO*5NHgkÇN15MKr!8V(,8n9xr>9G|r*@.f39lLi f l '?!)]il'?!)]`\'"?!-{-|`<`>aeaocAoea.,oeuraAOCGQyeoraAuXWAVYtubyvwhkeoxdcqvj ywtCOGUQTYVWjI97qeU13gR5T78K7<x   Q-,                                                                                           ?@1'N85UN7j'8r 1q8SUrc8``?N8 ?N  fQ-,                                                                                         %UdoV@BFeU@`` s,Cs hQ-,                                                                                           @rZOq*DUUmxUU9v`Vqr9``@q@<x  jQ-,                                                                                           ?@1'N85UN7j'8r 1q8SUrc8(M``*?N8 ?p0J  mQ-,$| )    0 3 ! $  $  8           "  !# !    *&   1  ,  1 * * * * * * * * * *   /  L  . 5 ! )$  3 2W + .* R! 3 3 5   L ! ). 3 6$$ 6$ 2* 7/ . 5 4     H B#@  8 -V :   # :: B B  'JK--%- ("( "  :UUrq#GG:Wr@:W8\r!UW  *  # G83N8GU&HqTQ3|r8U"a#3C78M;EaeaocAoea.,oeuraAOCGQyeoraAuXWAVYtubyvwhkeoxdcqvj ywtCOGUQTYVWjI88rq*G8*UUrN8 rq[  Q-,#{ '    0 3 ! $  $  8          "  !# !    +%  1 , 1 + + + + + + + + + +   /  L  - 5 ! '$  3 2W * -* R! 3 3 5   L  '. 3 6$$ 6$ 2* 7/ -5 4    H B#@   8 .V :   # :: B B  (JK .. & . )") "  ӍTV7 pS^7#eS *K]l$61h1BvRYzK ? ` gY"UT$&e@foT@9+.015WAmEWEIM0O*UbX\apsuvFx{x}c}5&tWWġ;V\; 'LAlLi f l '?!)]il'?!)]`\'"?!-{-|`<`>aeaocAoea.,oeuraAOCGQyeoraAuXWAVYtubyvwhkeoxdcqvj ywtCOGUQTYVWjIn: q|r9:A*T ?8) Q-,#{ '    0 2  $  $  8         "!!  "     +%   1  ,  1 + + + + + + + + + +  /  L  - 5  '$  2 3W ) -* R 2 2 5   L  '. 2 6$# 6$ 3* 7/ - 5 4    H B#@ ! 8 .V :   # : : B B  (J K .. & . *!* "  \tXN<PZS @],|vZ1NfJ#@]}.Vx \hȐ0Xq8X']vww9cqX\r89 s "%V&+*+C+78.aeaocAoea.,oeuraAOCGQyeoraAuXWAVYtubyvwhkeoxdcqvj ywtCOGUQTYVWjIIÎJ8loeuraAOCGQyeorauAXWAVYnlrumtiCOGhbUkvwQTYVWeaodcgq' qa;P}'@N8 8j  xQ-,(u~} *    1 3 % "  "  9  " $    !    # %& % (   ,  (4 0 4 + + + + + + + + + +   '  0  . + % *  3 2 - .  A% 3 3 + *  0 % *$ 3 6' 6* 2  8% .7 5  $ (  EE  E 9   / !  L E E!E!! & ) ( ' # \sXN<Y@C|uٞZ1n>e#DJew-"\V%@%]'CH  :X qY$&e@foX@?SSTp['< 9UӎշکێpTo 8.679M'NUU_Jkapsi f l '?!)]il'?!)]lL`\'"?!-{-|`<`>loeuraAOCGQyeorauAXWAVYnlrumtiCOGhbUkvwQTYVWeaodcgq' xJ8Î@N<j q#f zQ-,/| +% "   2 3 %" " " "  :  ' )    &    ( %+ %" ( %  ! %-"  ( 5  1"  5 . . . . . . . . . . "  '"  0  / + % +$  3 4 ,# /  A* 3 3" + *"  0 & +$ 3 7, 7* 4  9% / 8 6   $ (  E E   E :    0 ! %L  E  E  !E !! ) * - ' # 1#$Q~L4W+bcfg DEDGam $B#_KzQVyq&4=\sq8'A]vww9cq"\r896 ABGlmvzt}~ZDE4P[lX_8ϥжwr߷o3  `%'+6;`AGXRymi f l '?!)]il'?!)]lL`\'"?!-{-|`<`>loeuraAOCGQyeorauAXWAVYnlrumtiCOGhbUkvwQTYVWeaodcgq'a8@p[WwJ@~Qqt}\ |Q-,,y *% "   2 1 %" ! " !  9  ( )    $    & %* %" & %   %,"  &4 0" 4 - - - - - - - - - - "  '"  0  . + % *#  1 3 )! .  A' 1 1" + *"  0 % *$ 1 6+ 6* 3  8% .7 5  # &  E E   E 9    / " %L  E  E  "E "" ( + , ' $ *Ȋ).fhfjϧϩG8Qmm%8 d$I'Xtk()Z+gDKG!SL`2Kgl"q9E7zN9f8q@0EWc8z0\q+-k0-;`UUWdqi'j8twpC>lBf'f!H˼3ޑ39 < K`,LrPa} i f l '?!)]il'?!)]lL`\'"?!-{-|`<`>loeuraAOCGQyeorauAXWAVYnlrumtiCOGhbUkvwQTYVWeaodcgq'(TS0~i?b!-`@);~q~S P ~Q-,CLK !             " $     # &   !  !            0   +         A%   + *  0  $  ' *   %       E E  E       !L E E  E    ( UUUUr*qqUUG8UWrc8U8\r81UUg U U U r83N8GU&HqTQ3|r8U#?Ggji f l '?!)]il'?!)]lL`\'"?!-{-|`<`>loeuraAOCGQyeorauAXWAVYnlrumtiCOGhbUkvwQTYVWeaodcgq'j8r8*qrN8 rrDF Q-,&F, Z 'O H 'M ] T 0  E < S D.     "   /0 9 !4&5/(: > C !=7 \&Aaaaa  V4V' Q "N J W  I 6 U ]  !) +[ B ` Y L ? P R 8 + G 2 1_ 1X 1 1F    aa !*  % #  (/  /$  ^; #  3K-!   @!  1{Ah F'qYeqr>r> /hGMVQW^ak{=ʫҫ$r*PXr8;:;:==;:=;:=;:==;:=;:=;:YZjf  ;: =;: ;:; : =AMNYZ9\rQ UGV@q + Q-,          )         ) )   ))  )) ) ))  )) ) )  ( (        "       &     + # !  $ '     *        % %            1qxpC!;clq%_zz ]<$*/IN6e 5 5 _ d@ R ߷ P 8  ;>qq>:UTrx>q>8KUTx ff9QxZlB؇qGxa'r0000000QUG9 4H5 C93>34'453  0 15>\n" [[i<QG[jwu4Pm#>J[n4q  ' 283N8#dHqTQ3d|r8qq%T32C3JlL`\'"?!-{-|``aAaAoOcCgGqQxXwWaAvVyYcCoOgGuUqQTtYyVvWwIaao c g q x w a v y c o g u q 'tyvwi ;`* UUJUTr8*N8 2*RkAH  Q-,CKJ % "   " "     $ $        "& * "   %  ( !    "            "    B  4  #  M  ) H' 4     -  #) # ) .       ? 9    L     #9 9   @A  +   9r:N9\sn: 7yGÐs1@N:Ws;ttjUXqN<< * x J c N9U8*Z`n8|r88*'FeN9ÏlLi f l '?!)]il'?!)]`\'"?!-{-|`<`>eaocAoea.,oeuraAOCGQyeoraAuXWAVYeoxdcqrywtCOGUQTYVWjIqÏ8UN9V8U 8XK`y  Q-,GQP                       "                L   5  $   W  * R   5   L  .  $# $ * /     H B@   V :  :: BB JK !  :UUrq#GG:Wr@:W8\rUW  *  # G83N8GU&r 8 q  G3|r8UG#?GlLi f l '?!)]il'?!)]`\'"?!-{-|`<`>aeaocAoea.,oeuraAOCGQyeoraAuXWAVYtubyvwhkeoxdcqvj ywtCOGUQTYVWjI88rq*G8UUrN8 rYRQ-,HRQ                   ! #             L   5  $   W  * R"   5   L  .  $% $ * /      H B@   V :    :: BB JK    $ $O{5_DiDkx ) d O A< 7 % Yv $ p > | ^ k ; >rx@4BMV  [%  [ tQ*ziVuxXҬ&9%frM(lLi f l '?!)]il'?!)]`\'"?!-{-|`<`>aeaocAoea.,oeuraAOCGQyeoraAuXWAVYtubyvwhkeoxdcqvj ywtCOGUQTYVWjIM(4e6rM4@44<xff   Q-,                                                                                           W('32$&g /Z 333132^34``W32WRkAHff  Q-,CKJ % "   " "     $ $        "& * "   %  ( !    "            "    B  4  #  M  ) H' 4     -  #) # ) .       ? 9    L     #9 9   @A  +   fg G\+p(+ ?35\+z_ ?}#\+p =s   _ U  p Q z  37 ѽfkHٙ33|ZI &f / 2 f3fgs28Re_plLi f l '?!)]il'?!)]`\'"?!-{-|`<`>eaocAoea.,oeuraAOCGQyeoraAuXWAVYeoxdcqrywtCOGUQTYVWjIQǬ\p=pG'*= Q-,* ) ) ) ) )            "" #  $ $ & & & ( ( 420 32 33%   !   1.!,/.-'-    &&&&       //+ * * d#BUPj88҂U8: l2qUQUYpUW. ; uUOo= uU*fs2@ UU.38:PAO;=kmrt24_f+- G I V v 9:uZůa0aTUT16pTQ $Q       [.<(+!&]$*);^-/|,%_>?`:#@'="abcdefghijklmnopqr~stuvwxyz{ABCDEFGHI}JKLMNOPQR\STUVWXYZ0123456789   $$`-+I,"&#%) '!(*$? '"h%-qa{bc*de fg h i ]j nk l m nopqrxstuv#wSxpyz3aYbocdefghijhl mn o1p/d@r[spt{uvw&eyc)dr'f*attmt(l9mHneBes:rPsFtRuOvKwcesItg1i0i=ic rJod m inZa eGtaSerp gys>t\r]s o\n im`riVs[u^tmaXtctewenpc|hr izaemsnbxpoqrvo tlla{iMt}lileeni ceoc ri bam~ rooirsi out t cabrse h gtrmilundeqr sm ua miytcrg ere sm agno etsoia b raoon edrnir s tkbo vee lydo liuriommnp naMrOsc e eceir hkygea m gasnt ptnooavg t eicl inrttr onse!tr uozai# d$tf daecdvaXtl"t h t'r s(tu3e+d;ie7it e*i t5enEam:r\nGe2o4t cKi6ot e*i=aJoMtt gnDmXuutd/t< s q dCsYcAtZeTwi h\ i f_ldin efn l^rgnamtvbahaqn yeen a ho iolkmynisogvnur pkrbe*u1un e persanc>de\rnd}iekr d lo nalb*aubcdefgh ijkl7mPnopq&rMst4uDvbwHxky]zaizo glaruoe drhi=eo betii orftunolmdenraiwrnla roucrsaucfeVirmgi lbheaone eat uie nllio olrnouuaen ue viylhia lcioo,a!no deldn.icg-lmt"obade e tt%iy8a cb*i0esrgJi!oBr a yi@opoe\r6s2tc ntfUar"yadce+lfg9ntichkDgwlnjo i:l sstuOeWr e<tXissle$iFonlhlbi;s#cuYe$fe%zotiavminopzalkstualnc=irXrt rrolarn|apew}et&uhi%rul stoa ceszuilsnBltseetr(si'euabcdeft gizacdmiopqrslmnhp%oant u(vwviina sitel)dra lineninosamMnobichabcehhznn hr%alaareo+thgimnbceonmrs0t2ulc oypg!na iguzn pkmrspovs+aga he behyi,gheclh,luTngr<ar1s7t=e n9n-rKiaVreWig:oehiak lcdop gstu a naOia a)bcivafl ye ihbfd esozivinta.bs/def3hijk8l/m3nopcsr<stuv=we:yrkliaiiieiz tioipouut5rzbr de4fnwgir-lano d*e6ort7auuaXd z!eng%pnXiedliongocprys-tcbu* a a zn dit ho/f(toa lo0do$igr"oaOt-l1mnnVsti2std ew oye ovlmnofg6r:stulm nhi arst>aa*cieclhui pkGl'lnooqrKs.tusaeyz$tiznhiy hvis mn9a(oden(ui bcdd e2g>hicl?e?nspirstt+vIa mayY"itb@a^iAb"i'cSa pdkBno'PstUntlWmdneszr%i%szarc|ieepfDb"tictlmnKopaialsEtaer-gi ze}iih%ioaztreadii%eHoic.elnF-ncp mTrVs[teywbmila aCs!toengio]ale%a eaitXi etg'ciCoIalmnctp%irVsasvwebsza ifd gploVson buXuasttetc vin+tisLbiOsm f dufw"uitil mnapar-sMte iBiei dygir*i k6iol"coioNvfis lyi\OabcRdxe/fTgThij;klm[nop er\stuvwKay&ana)q riioiiStIoRaomrahtu;eumniQbc sfgFaVnXtoe8mnWa"yr ete:vZi z yitiabAcEdedti pXtlmC-nEpqNr s=tiDvaZaya7oe!thoiagiieo4o biMal pZupo'iylwcuhn pynbe$i-awDoye neBtupsezUauccdWefgteofPltjn-o"pl rosmtsYvc]a1lcnves gsladDlm npnpds t$d e>fga'tssnlmn{orpmrseu vcxa,.bEcaduewfglRh iyjklmn.oCpqZrstuv wxyel^bcdaegXleis lmncoe-rs2tav cee%iaiihekahimtrpito ysla_u cceebDruIi*fy8l#r sRoVtmretu eAii tl/mnl`a n3rXd@ecs ecjiabcrUoelrSnbumcdtf:e-ftdfi7lmnzap\o9a)bst ieTux{uibc nlnocd rv gunf-g ysmndteiXrhtia=slvare!efbiicg yla dobglstuabcdtogiOhbc ce nggw#r-sc mnogp hsabevB nes eiisgi gdglnophscn eugaBlynXmnfnhc iaseatcdezXn tiiietnowxastuo aayXz eif'ob g6ncm eYiVe'uXrst lswovo3ikst ufgBtiizdl i=hlplrs9t*uawksl@e sth l%knlaeoQat rst"ucd^a"b4che bnhsifir%um[nyoozg5nLsxturRw2t amaicBceSestb ceae%zDn-oal~ettuO vc rnauwthe}vnr6n~iunt|rleBni;aicbrn c biKa=rlmrnao qi6std^aucnoOeglrhiok mcmlopXnostuBn wcdcgg f-pgcid>mntal sse u9nhil r ttnoalropeu*sri yznpaporsteai aieyligo irl6onds(tru+ahed ldeneh i l cne vnaqtrh4a=bDhd]e3/fshmioac,lmnqo=phirtsKtubnceysg=iKitllmerndIl rntu%any t%e l>s ti ta(lyodeorgi*ea b*cd nyy a s o'el9m nKi5nar}cd1ovgssszJl uTnsy*u9a@ n^s>a er sCeI iai i de hioz isveugtCosnem$ni s\zrSsOtab zdewughi hy lmn ?opor s(t ufw l yiylXmnaoe_rbstdiZielizohooao n9t-e bs siyg ad^eoetZiils-n-ooorstMva vcuenoza Th'dlm n oi'rrs a u vHce nz}di ss"didto$g r n apu{te mSl}nixsy\r tn5aa Uabst oef uh iik [l g/m.n o=p 5a irus t ue wn yy c d sl 0 goi b kn etyg~oit*antp n oiWdrsDp Revd bce ea girye l m 7nVn 1p )a er1sdKuh)ehy s  z Lanl /c 8dPipr Fl at o klrm InMo pKa r Cs O tu <ab laeo pe r do iyanoha e9cveWs sg a nypllm Zn Vo pd {r [s ct dv e g*arnZi l m wn oip r se u v r$k&antu e os g t pevsm nei hs t>iuy .a b c )d 9e sf Qghijk ul m n o p q r s /tu ,v=w xy Tzl m nc$p i ebs ti iaal r>coua rtmu_apn 3r sea t .t ay cXea dh i nyl  ur o sBn #rp t ulmior ar6nd emct 5i eaDl ae "ow er LaVdui g-t5aheol e Anrtu r -stb nr czaeq<t elb h Vi ^trltMa JoDgldrnPb 6u 2dg Gntr_uvt>m e klr oi\r cav}e >f aef Ni yn il%g ;lan Coabt Zatuv [e ll iBdrorcnoslt$len Kuz e rtaieee rscibac kl uhoieryu fua st eh iai bc eohld inKap g a Xai lc fd e n g n ijtklen Eo h iy s tund$dfy ra au2ld ega isstm o ochzagvuo en%ts t qs gr s rsl m napars t&u oiamnb a d c Rtef k h i ck lmyo p st s -tua p La ?eee e Hiih 9ila Do cgo o rg r Idt Fulmaloz dlsncbg Vrlglea .ro_tmn iti aSdtt Se o 1r sbs s wyro2ol ab o >u ef _eh iyk plm yn oe l ^r ustd-ew gcoyole [nhia lr MstrsiuKi bc doyg gyi"d*e {m n ra rVs t se v aeibnti t eg ibiielciha%or &r eXcc rr 4 and Ue c gn blm nq p ss a .b uc d ef [gth 'ij k Al Nm\n go wphu/r \s t u v.wg yacbn"cmf gefrsnt m nl p a r szae v e 2yg iwi'ag oa&ooaes tuiahyge  i sci ek Zrda ab c d ;p f gnzWtkl 5m no"bqsrs 6t ?ivi ilzFa 3hop Fe a tc i qHyg r*u : o wl*eSn iRa i ezSt oi !odiTnmunaolthit+bcc igf Lg s \ednm n#o Spza Ur st Quvs bh Tincler'a e=ir ea*ea i sesth ki%ei o n e n n tr:thi < uab ^cnefa i miabha m hopgl |s-tt$mn n a /b=cds e/fh Yi nk/l m /n 1o P/po3r nust lu zwb c%ad gh#i ic lcl n ips r s tts i zdcl eez a h i lhonv%a i tWtet v a "andeae i ie a'che i l glesnt i%y ry er a ahdiel gir r%y a t t a 2d r ?ig tu$ si l m -nho #e or s tm v cd=sa9gt i ik (lm Cn a f+e ?r = s(t ;uv*e %s$gy 6ips az Aazo Nrie ii h ]iaay d a _oguet le n)oyt#n s t Mt rsr Kszu vhi Zlm nsp msto u a[b c def g [hij&k/lm,un>oVRpq r]\sqtuTvRwBiryz Lb cu;se agctk lDm n Viak r s t kuVvc ceukni poBa l mt heat h i qetal i olir asu n e ba a if ce tiibe ivo u b w-t a ra iez er1i\h iel Zl ni o r rbs aFu a ceynapna b cdD l t gl e)e g l m 2-no9pq r(-s tsd v w Ma bLi de fg qr'otkamn ohieas!t+gioelr#i$iHsgp/o v4llti0aw bcde"cg iiKaAil@m= nb*poGrSs\t-uRvwcNe eylze _r_ai cbPe_ssllgitWrlmdokpgYoemtat iteeQrl bwimefemcgnfp`r synnu pa|ee dhe{f isineamSnotndotabcdefgTh ij klFmXnu opqrst uvw ddy ea f$bleleliircrsttccr reuhi+tdlltooiiratu o eltn iu errttvaiin oeyroi tilenlna"znreue*eis-ygstcdcfg meonltntbsegst$iaredecf i r,iyl.e'd ovprstt7uveaycdhSflalc d lbn ontsZstn v=iDmnng)a'b"l s>enni3ir;etmy?oEpriWac:cdVes"agdcihLknncdod*s _snt u vOpd;moKeulsPi uvdhgeen]ri kaatigple\rshoi~a n fhe~o s preautiae yguihimwno$phrstIusheiywy!atcsh@laect lyn-oiae l;tuopt uitoaa ron_gvb lrildg}nyo tae<aleilhirssc*s1ofbcnn*ecd*sste lsnistderovi%nienot;iaaadve ee si y a+a/bedLefgvhi tkl/mtno/pr r\s.tuew cdZitgrKie alh5nepa rc0tav raycncVitrspSayc`dXen meatk?lBhBnho niTrCy't mnobsuvbtuv\rgc"eein a%ims reoiania8ensejigCslitzbo a nest umVyKa-yIcpdDet!gna"satl%inKoyiYa uoQteo cde*i*gGuNiv`oFlecnd pirR-st~ud ltanelerftiocnefoc { safl telelrstivest hiarVhtee lh5iiKoeip b:haefeubwl mng rrr sta#b2c!dNejf{ ghijklmnopiRr1s:t\uQvw fdybc scfe/nifti9lm*naparstuv=ib i^zretng oiegKeao7h)iet al@one=rerzuEivwnlmt3ab1c?`diefg Li*istJl no`pucrsht: ur vwapaiaieei&eiol,ioaurdeurri lhayutepocyiirlt boc%n ngua s tne%deritjbt6i oa bcdep|gdMsgtllmnopq~ast av d d ei g g@shaonpleerliiee niitstloueg9asainpe&aroiesnoil cWmt2i Lorp ttyuey c gimsthvbcn efp ps s k lm no perst iv"a xe s e piai=heveaFh i oPl)entoi voc=nyogr cto fdbaby cy4ecoBhi#a VsXno/eopiLic lrswi;vwe@rsbo deeyg,n kZ e v9ldAicndatsoev"giOl cnmJnar=sk6sttonyorttt a=bc=de3ftghim kTl.mRno2p qrCstwuvn w ez yEbcciasae iw9leXnip mootuv w ta nu pedfn hFi vdleloiph luur!e"svZi atbcdi}ngn ieflmnnjptr^s%huu vOw xl*avc dUe5dg e~inopl e n ga vrt eegwli nyh"rb6cd%alg ncdillEn-o o'cr-st u-vevaa zyeeieiinc nufeo%z oi,lmUnnporratvJdlwa%siIn*eXnoh1ilrllnoovla InDce7e(es tBid+lcln%dDp-edatugw'u g"elOmNnBcpVrno twfad m ndplXriis tenlaicabFtHzicgy_iyllmnlplnrjo ara.bc/de.f/g/hBiend0l/m\n]o/pllrusKtuvwayVzthe e%iiihksl*eRaoeQe&uaDhieOdOlyi^o"nh rt+aiXw ayB-ctefha cd*en{b cdr2f eivi(lilmnWtpbrstKuvwx aec1cecddiEantWiltBnsnio zpr\zkvvuaotc e i$euicHaMrancEd-eagraea lmn-o$ p2ir&stuioexy*nldhKaKa asereteisfla boo"i ms-abcde fgirztl-mEn-o[n qyXst uv-vay"a-zepbcXd!gf g m io po;mZntu-aer s4e9uywidbvci-go e nh Viepu~ss i stas{cnt%vmAns'pecNslm evhhhhio h vbacbu de2fewiai#amsnaporsbil-n iapoyabcdefglijk lm%no=plQrlsytuTvXrYxdVzbcan eda7rD^i biilnsirrltbvtnrdeuteiy ar*sbovt-ccseusntn&arsoslss nis tritaw vcd eacgrieulXm1r^o Labstvuvii)al areopi.irs Liu&i"nn&estumnuyzns ervir'ieelgiepDaDh=i(tanbcd9e1fUt a\ic3e*l`i9nboBp$f%csGtu b drno da u c-te nipXizvilteapievsWtu{iu/lg loCn2oosdisfgiusoazMm neu%ieudeeoliOne%tmivii yaXs tdyfhgl nkltno p%trstavzpaecdRuegleibnc^rSr(tnguboilm nipojrdta gur e ilXn|n Layorstlaiot tvvndim gtyC icdayvdelf6nu%dlsrnthCors lInvenpa%sZiLt7eihklme6abVhretah? i1o kli9nfoprstbccdygmi*elmatcdrst lvncsmrs(t]aJcbe zehCirdtcopngpbTt u mx rp'hi sKabcdve rg3hielUmnRoparsftwrs tlmlcdogs iduZe=gc0aim<no\i xso)tuos c re n pir mtvoostudabe.ilmotuz     *  - ;  F J  P 3RT  j  T g| 5)  O -J8    O^4